OSCA025960-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025960-RA
Unique NameOSCA025960-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length273
Homology
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|913332813|ref|XP_013198057.1| (PREDICTED: uncharacterized protein LOC106140950, partial [Amyelois transitella])

HSP 1 Score: 130.954 bits (328), Expect = 3.234e-33
Identity = 68/88 (77.27%), Postives = 77/88 (87.50%), Query Frame = 0
Query:   20 FSSGHVAAMMAAMQQSQTEAFERLLERIVHQPSSPTSAQTPTLSAGSEIFTHCTARFSGDTGESVEAFIDAIQSXKECANVSEENALR 107
            FSSG +A+MMAA+Q+SQTEAFERLLER++ QP SPT A TP  +AGS  FTHCTARFSGD G+SVEAFIDAIQS K+CANVSEENALR
Sbjct:   31 FSSGQLASMMAAIQRSQTEAFERLLERVIRQPPSPTPASTPAFAAGSGTFTHCTARFSGDAGDSVEAFIDAIQSYKDCANVSEENALR 118          
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|914553790|gb|KOB64681.1| (Uncharacterized protein OBRU01_21716 [Operophtera brumata])

HSP 1 Score: 100.908 bits (250), Expect = 1.657e-20
Identity = 67/157 (42.68%), Postives = 91/157 (57.96%), Query Frame = 0
Query:  103 ENALRIIKRKLLEWPLGRALLYAPFSIMEIIH-PNYETFLSTVKSLKPRLTARVHVVP---QKRLPASPVSSHSIKTPRRESPASNETPGSNEDPAT--FLEMMDLLAKQTQAIESVATQVSIYVASNLE---ESFESVLDSTTD-EEFGAPSLNVL 249
            E   R IKRKLLEWPLGRA+LYAP  + E +H  +Y+ F++TV++LKP LT+R        +KR   S  S+ S KTPR        T   +ED     F +MM ++  QT+AIESV+ +V+       E   +S+ES  +ST D EEF APS   +
Sbjct:   85 EKKYRAIKRKLLEWPLGRAVLYAPHKVAERLHEKSYDQFMTTVRTLKPTLTSRDMASGSSHRKRRSTSQESTASAKTPR--------TDNLSEDMQCTLFEKMMQVITSQTKAIESVSEKVNSLTLEREESQPDSYESAEESTQDEEEFDAPSFRAM 233          
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|827563728|ref|XP_012552393.1| (PREDICTED: uncharacterized protein LOC105842708 [Bombyx mori])

HSP 1 Score: 79.7221 bits (195), Expect = 2.657e-14
Identity = 42/101 (41.58%), Postives = 64/101 (63.37%), Query Frame = 0
Query:   20 FSSGHVAAMMAAMQQSQTEAFERLLERIVH-------------QPSSPTSAQTPTLSAGSEIFTHCTARFSGDTGESVEAFIDAIQSXKECANVSEENALR 107
            F++ ++A++MAA+Q+ Q  AFERL +R+               +P+SPTSA   TL+  S  F  CTARFSG  G++++ F+DA++S K+CA+V    ALR
Sbjct:   31 FAANNMASIMAALQERQMAAFERLFDRVFENKTQFQSWATPTSEPTSPTSA---TLAHHSGNFASCTARFSGAPGDTLDGFLDAVESYKDCADVGHAIALR 128          
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|512886014|ref|XP_004921691.1| (PREDICTED: uncharacterized protein LOC101740708 [Bombyx mori])

HSP 1 Score: 79.7221 bits (195), Expect = 2.988e-14
Identity = 48/108 (44.44%), Postives = 63/108 (58.33%), Query Frame = 0
Query:    2 PPTISGHNPTNLASKRQFFSSGHVAAMMAAMQQSQTEAFERLLERIVHQP--SSPTSAQTPTLSAGSEIFTHCTARFSGDTGESVEAFIDAIQSXKECANVSEENALR 107
            PPT SG+            S   + AMM+  Q++Q E FE+LL  +++Q   SSP  AQ P L      F  C AR+SG   ES++ FIDA+++ KECANVSE NALR
Sbjct:   27 PPTASGN-----------ISVNDMVAMMSTWQRNQEETFEKLLHTVLNQSHRSSPPPAQ-PALGN----FASCKARYSGAPDESLDGFIDAVEAYKECANVSETNALR 118          
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|943979160|ref|XP_014370475.1| (PREDICTED: uncharacterized protein LOC106720343 [Papilio machaon])

HSP 1 Score: 78.9518 bits (193), Expect = 8.305e-13
Identity = 43/106 (40.57%), Postives = 60/106 (56.60%), Query Frame = 0
Query:    2 PPTISGHNPTNLASKRQFFSSGHVAAMMAAMQQSQTEAFERLLERIVHQPSSPTSAQTPTLSAGSEIFTHCTARFSGDTGESVEAFIDAIQSXKECANVSEENALR 107
            PPT +G+            S   +AAMM+  Q++Q E FERLL  +++    P+S   P        F  C AR+SG   ES++ FIDA+++ KECANV+E NALR
Sbjct:   27 PPTTTGN-----------MSVNDMAAMMSTWQRNQEETFERLLHTVLNHSQRPSS---PPAQPAHGNFASCKARYSGAPDESLDGFIDAVEAYKECANVNETNALR 118          
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|512938903|ref|XP_004934116.1| (PREDICTED: uncharacterized protein LOC101738870, partial [Bombyx mori])

HSP 1 Score: 72.4034 bits (176), Expect = 4.723e-12
Identity = 40/92 (43.48%), Postives = 58/92 (63.04%), Query Frame = 0
Query:   29 MAAMQQSQTEAFERLLERIVH-------------QPSSPTSAQTPTLSAGSEIFTHCTARFSGDTGESVEAFIDAIQSXKECANVSEENALR 107
            MA++Q+SQ  AFERLL+R+               +P+SP S+ TP   +G+  F  CTARFSG  G+S++ F+DA++S K+CA+V    ALR
Sbjct:    1 MASLQESQMAAFERLLDRVFEHKTQLESSATPTSEPTSPPSS-TPAHHSGN--FASCTARFSGAPGDSLDGFLDAVESYKDCADVGHAIALR 89          
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|1073533719|gb|JAT83971.1| (hypothetical protein g.9731, partial [Pectinophora gossypiella])

HSP 1 Score: 72.4034 bits (176), Expect = 7.593e-11
Identity = 61/164 (37.20%), Postives = 79/164 (48.17%), Query Frame = 0
Query:  103 ENALRIIKRKLLEWPLGRALLYAPFSIMEIIH-PNYETFLSTVKSLKPRLTARVHVVPQKRLPA------SPVSSHSIK---TPRRESPASNETPGSNEDPATFL--------EMMDLL----AKQTQAIESVATQV----SIYVASNLEESFESVLDSTTDEE 240
            E   R IK ++L WPLGRALLYA  +IME IH P+Y+ F+ TVK LKP L  R     Q R           VSS S K   T   +  A+ +   + ED    L        EM+D L     +Q + I+ + +Q           +L ESFESV DST  +E
Sbjct:  132 ERRFRAIKSRVLRWPLGRALLYAHHNIMEKIHEPDYQAFMDTVKELKPALVNRHKASCQLRGVEPDGSFDDSVSSASQKRHSTSSLDDRAAPKRVKAQEDNNQLLAAVLNKQMEMIDRLLNVSTEQNENIKKLLSQTQDCPKTDKGPDLNESFESVPDSTNSDE 295          
BLAST of OSCA025960-RA vs. genbank:protein
Match: gi|930669655|gb|KPJ10535.1| (hypothetical protein RR48_06329 [Papilio machaon])

HSP 1 Score: 71.633 bits (174), Expect = 9.731e-11
Identity = 45/119 (37.82%), Postives = 66/119 (55.46%), Query Frame = 0
Query:    6 SGHNPTNLASKRQFFSSGHVAAMMAAMQQSQTEAFERLLERIVHQPSS-PTSAQTPTLSAGSEIFTHCTARFSGDTGESVEAFIDAIQSXKECANVSEENALR----IIKRKLLEWPLG 119
            SG+N T        F+   V+A+MA++Q+SQ E F+ ++  ++ Q SS P +   P ++    +   C A FSG  GESVEAFIDAI+S  EC  VS+ N +R    ++      W LG
Sbjct:   43 SGNNST--------FNLDDVSALMASLQRSQAETFKNIMSYVMEQRSSTPAAPPMPPVNVDGTL-ARCKASFSGAPGESVEAFIDAIESYTECVQVSDANIIRGLAMLLSADAATWWLG 152          
The following BLAST results are available for this feature:
BLAST of OSCA025960-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 8
Match NameE-valueIdentityDescription
gi|913332813|ref|XP_013198057.1|3.234e-3377.27PREDICTED: uncharacterized protein LOC106140950, p... [more]
gi|914553790|gb|KOB64681.1|1.657e-2042.68Uncharacterized protein OBRU01_21716 [Operophtera ... [more]
gi|827563728|ref|XP_012552393.1|2.657e-1441.58PREDICTED: uncharacterized protein LOC105842708 [B... [more]
gi|512886014|ref|XP_004921691.1|2.988e-1444.44PREDICTED: uncharacterized protein LOC101740708 [B... [more]
gi|943979160|ref|XP_014370475.1|8.305e-1340.57PREDICTED: uncharacterized protein LOC106720343 [P... [more]
gi|512938903|ref|XP_004934116.1|4.723e-1243.48PREDICTED: uncharacterized protein LOC101738870, p... [more]
gi|1073533719|gb|JAT83971.1|7.593e-1137.20hypothetical protein g.9731, partial [Pectinophora... [more]
gi|930669655|gb|KPJ10535.1|9.731e-1137.82hypothetical protein RR48_06329 [Papilio machaon][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_8153contignewscf_8153:3845..4666 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025960-RAOSCA025960-RAOstrinia scapulalismRNAnewscf_8153 3845..4666 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025960-PA ID=OSCA025960-PA|Name=OSCA025960-RA|organism=Ostrinia scapulalis|type=polypeptide|length=273bp
MPPTISGHNPTNLASKRQFFSSGHVAAMMAAMQQSQTEAFERLLERIVHQ
PSSPTSAQTPTLSAGSEIFTHCTARFSGDTGESVEAFIDAIQSXKECANV
SEENALRIIKRKLLEWPLGRALLYAPFSIMEIIHPNYETFLSTVKSLKPR
LTARVHVVPQKRLPASPVSSHSIKTPRRESPASNETPGSNEDPATFLEMM
DLLAKQTQAIESVATQVSIYVASNLEESFESVLDSTTDEEFGAPSLNVLP
QEDPIPSSASPDALMEEAILTRY
back to top