OSCA025961-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025961-RA
Unique NameOSCA025961-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length32
Homology
BLAST of OSCA025961-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 62.003 bits (149), Expect = 2.655e-10
Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0
Query:    1 KVAGRAWMRAAQDRSLWKTLGEAFVQQWTSFG 32
            KVAG  WM+AAQDRSLWK+LGEAFVQQWTSFG
Sbjct:  466 KVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 497          
BLAST of OSCA025961-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 61.6178 bits (148), Expect = 3.137e-10
Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0
Query:    1 KVAGRAWMRAAQDRSLWKTLGEAFVQQWTSFG 32
            KVAG  WM+AAQDRSLWK+LGEAFVQQWTSFG
Sbjct:  447 KVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 478          
BLAST of OSCA025961-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 61.6178 bits (148), Expect = 3.371e-10
Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 0
Query:    1 KVAGRAWMRAAQDRSLWKTLGEAFVQQWTSFG 32
            KVAG  WM+AAQDRSLWK+LGEAFVQQWTSFG
Sbjct:  332 KVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 363          
The following BLAST results are available for this feature:
BLAST of OSCA025961-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 3
Match NameE-valueIdentityDescription
gi|134001323|gb|ABO45239.1|2.655e-1087.50reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|3.137e-1087.50reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001247|gb|ABO45233.1|3.371e-1087.50reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19987contignewscf_19987:4..102 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025961-RAOSCA025961-RAOstrinia scapulalismRNAnewscf_19987 4..102 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025961-PA ID=OSCA025961-PA|Name=OSCA025961-RA|organism=Ostrinia scapulalis|type=polypeptide|length=32bp
KVAGRAWMRAAQDRSLWKTLGEAFVQQWTSFG
back to top