OSCA025962-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025962-RA
Unique NameOSCA025962-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length75
Homology
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|910328900|ref|XP_013167682.1| (PREDICTED: myotubularin-related protein 4 isoform X2 [Papilio xuthus])

HSP 1 Score: 142.895 bits (359), Expect = 7.043e-38
Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVVHQMM QYPCSFEFNEAYL+ L
Sbjct:  416 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVHQMMLQYPCSFEFNEAYLIKL 480          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|943948566|ref|XP_014357337.1| (PREDICTED: LOW QUALITY PROTEIN: myotubularin-related protein 4 [Papilio machaon])

HSP 1 Score: 142.895 bits (359), Expect = 7.191e-38
Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVVHQMM QYPCSFEFNEAYL+ L
Sbjct:  567 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVHQMMLQYPCSFEFNEAYLIKL 631          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|910328896|ref|XP_013167680.1| (PREDICTED: myotubularin-related protein 4 isoform X1 [Papilio xuthus] >gi|910328898|ref|XP_013167681.1| PREDICTED: myotubularin-related protein 4 isoform X1 [Papilio xuthus])

HSP 1 Score: 142.51 bits (358), Expect = 7.767e-38
Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVVHQMM QYPCSFEFNEAYL+ L
Sbjct:  473 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVHQMMLQYPCSFEFNEAYLIKL 537          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|930675697|gb|KPJ15953.1| (Myotubularin-related protein 3 [Papilio machaon])

HSP 1 Score: 142.51 bits (358), Expect = 8.988e-38
Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVVHQMM QYPCSFEFNEAYL+ L
Sbjct:  530 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVHQMMLQYPCSFEFNEAYLIKL 594          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|930653674|gb|KPI96011.1| (Myotubularin-related protein 3 [Papilio xuthus])

HSP 1 Score: 142.51 bits (358), Expect = 9.356e-38
Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVVHQMM QYPCSFEFNEAYL+ L
Sbjct:  127 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVHQMMLQYPCSFEFNEAYLIKL 191          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|930681175|gb|KPJ20715.1| (Myotubularin-related protein 3, partial [Papilio xuthus])

HSP 1 Score: 140.198 bits (352), Expect = 2.491e-37
Identity = 59/65 (90.77%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVVHQMM QYPCSFEFNEAYL+ L
Sbjct:  307 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVHQMMLQYPCSFEFNEAYLIKL 371          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|909552182|ref|XP_013144333.1| (PREDICTED: myotubularin-related protein 4 isoform X2 [Papilio polytes])

HSP 1 Score: 139.813 bits (351), Expect = 7.384e-37
Identity = 58/65 (89.23%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVV+QMM QYPCSFEFNEAYL+ L
Sbjct:  416 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVYQMMLQYPCSFEFNEAYLIKL 480          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|909552174|ref|XP_013144303.1| (PREDICTED: myotubularin-related protein 4 isoform X1 [Papilio polytes] >gi|909552176|ref|XP_013144311.1| PREDICTED: myotubularin-related protein 4 isoform X1 [Papilio polytes] >gi|909552178|ref|XP_013144318.1| PREDICTED: myotubularin-related protein 4 isoform X1 [Papilio polytes] >gi|909552180|ref|XP_013144326.1| PREDICTED: myotubularin-related protein 4 isoform X1 [Papilio polytes])

HSP 1 Score: 139.813 bits (351), Expect = 7.909e-37
Identity = 58/65 (89.23%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREWLDFGHKFADRCGHQF AE+PNERSPIFLQWLDVV+QMM QYPCSFEFNEAYL+ L
Sbjct:  473 GFRVLIEREWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLDVVYQMMLQYPCSFEFNEAYLIKL 537          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|913332427|ref|XP_013197841.1| (PREDICTED: myotubularin-related protein 3-like [Amyelois transitella])

HSP 1 Score: 135.961 bits (341), Expect = 1.818e-35
Identity = 53/65 (81.54%), Postives = 62/65 (95.38%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSL 65
            GF+VLIEREW+D+GHKFADRCGHQF +++PNERSPIFLQWLDVVHQ+M QYPCSFE+NEAYL+ L
Sbjct:  475 GFRVLIEREWIDYGHKFADRCGHQFGSDDPNERSPIFLQWLDVVHQLMLQYPCSFEYNEAYLIKL 539          
BLAST of OSCA025962-RA vs. genbank:protein
Match: gi|509173123|gb|JAA84682.1| (Myotubularin-related protein 3, partial [Pararge aegeria])

HSP 1 Score: 122.865 bits (307), Expect = 9.034e-35
Identity = 55/73 (75.34%), Postives = 63/73 (86.30%), Query Frame = 0
Query:    1 GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQYPCSFEFNEAYLVSLEGGIISAI 73
            GF++LIE+EWLDFGHKFADRCGHQF AE+PNERSPIFLQWL VV+QMM QYP SFEFNEAYL+ L   + S +
Sbjct:   25 GFRILIEKEWLDFGHKFADRCGHQFGAEDPNERSPIFLQWLHVVYQMMVQYPWSFEFNEAYLIKLATHVHSCM 97          
The following BLAST results are available for this feature:
BLAST of OSCA025962-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910328900|ref|XP_013167682.1|7.043e-3890.77PREDICTED: myotubularin-related protein 4 isoform ... [more]
gi|943948566|ref|XP_014357337.1|7.191e-3890.77PREDICTED: LOW QUALITY PROTEIN: myotubularin-relat... [more]
gi|910328896|ref|XP_013167680.1|7.767e-3890.77PREDICTED: myotubularin-related protein 4 isoform ... [more]
gi|930675697|gb|KPJ15953.1|8.988e-3890.77Myotubularin-related protein 3 [Papilio machaon][more]
gi|930653674|gb|KPI96011.1|9.356e-3890.77Myotubularin-related protein 3 [Papilio xuthus][more]
gi|930681175|gb|KPJ20715.1|2.491e-3790.77Myotubularin-related protein 3, partial [Papilio x... [more]
gi|909552182|ref|XP_013144333.1|7.384e-3789.23PREDICTED: myotubularin-related protein 4 isoform ... [more]
gi|909552174|ref|XP_013144303.1|7.909e-3789.23PREDICTED: myotubularin-related protein 4 isoform ... [more]
gi|913332427|ref|XP_013197841.1|1.818e-3581.54PREDICTED: myotubularin-related protein 3-like [Am... [more]
gi|509173123|gb|JAA84682.1|9.034e-3575.34Myotubularin-related protein 3, partial [Pararge a... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0035335 peptidyl-tyrosine dephosphorylation
molecular_function GO:0046872 metal ion binding
molecular_function GO:0004725 protein tyrosine phosphatase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010569Myotubularin-like phosphatase domainPFAMPF06602Myotub-relatedcoord: 1..66
e-value: 5.3E-31
score: 107.5
IPR010569Myotubularin-like phosphatase domainPROSITEPS51339PPASE_MYOTUBULARINcoord: 1..75
score: 26.921
NoneNo IPR availablePANTHERPTHR10807:SF50MYOTUBLARIN-RELATED PROTEIN 3coord: 1..65
IPR030564Myotubularin familyPANTHERPTHR10807MYOTUBULARIN-RELATEDcoord: 1..65
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILY52799(Phosphotyrosine protein) phosphatases IIcoord: 1..71

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_38399contignewscf_38399:816..1043 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025962-RAOSCA025962-RAOstrinia scapulalismRNAnewscf_38399 816..1043 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025962-PA ID=OSCA025962-PA|Name=OSCA025962-RA|organism=Ostrinia scapulalis|type=polypeptide|length=75bp
GFQVLIEREWLDFGHKFADRCGHQFAAEEPNERSPIFLQWLDVVHQMMAQ
YPCSFEFNEAYLVSLEGGIISAIMS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: Molecular Function
TermDefinition
GO:0046872metal ion binding
GO:0004725protein tyrosine phosphatase activity
Vocabulary: INTERPRO
TermDefinition
IPR029021Prot-tyrosine_phosphatase-like
IPR030564Myotubularin_fam
IPR010569Myotubularin-like_Pase_dom