OSCA025964-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025964-RA
Unique NameOSCA025964-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length67
Homology
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 117.472 bits (293), Expect = 3.724e-30
Identity = 56/65 (86.15%), Postives = 60/65 (92.31%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            ADGRWG+KVLEWRPRAG RSVGRPPTRWTDDLVKVAG  W++AAQDRS  KSLGEAFVQQWTS+G
Sbjct:  299 ADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 363          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 118.242 bits (295), Expect = 8.450e-30
Identity = 56/65 (86.15%), Postives = 60/65 (92.31%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            ADGRWG+KVLEWRPRAG RSVGRPPTRWTDDLVKVAG  W++AAQDRS  KSLGEAFVQQWTS+G
Sbjct:  433 ADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 497          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 117.857 bits (294), Expect = 9.669e-30
Identity = 56/65 (86.15%), Postives = 60/65 (92.31%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            ADGRWG+KVLEWRPRAG RSVGRPPTRWTDDLVKVAG  W++AAQDRS  KSLGEAFVQQWTS+G
Sbjct:  414 ADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 478          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 105.916 bits (263), Expect = 7.885e-29
Identity = 51/64 (79.69%), Postives = 57/64 (89.06%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            DGRWG+KVLEWRPR G RSVGRPP RWTDDLVKVAG +W+R AQDRSS +SLGEA+VQQW S+G
Sbjct:    2 DGRWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASHG 65          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 105.531 bits (262), Expect = 2.457e-28
Identity = 50/64 (78.12%), Postives = 56/64 (87.50%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            DGRWG+KVLEWRPR G RSVGRPP RWTDDLVKVAG +W+R AQDRSS +SLGEA+ QQW S+G
Sbjct:   19 DGRWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 82          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 108.227 bits (269), Expect = 1.766e-27
Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSY 64
            DGRWG+KVLEWRPR G RSVG+PP RWTDDLVKVAG  W+RAAQDR+  +S+GEA+VQQWTS+
Sbjct:   32 DGRWGRKVLEWRPRTGRRSVGKPPARWTDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWTSH 94          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930654247|gb|KPI96582.1| (hypothetical protein RR46_12612 [Papilio xuthus])

HSP 1 Score: 101.293 bits (251), Expect = 7.113e-27
Identity = 49/64 (76.56%), Postives = 55/64 (85.94%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            DGRWG+KVLEWRP  G RSVGRPP RWTDDLVKVAG +W+R AQDRSS +SLGEA+ QQW S+G
Sbjct:    2 DGRWGRKVLEWRPWTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 65          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930681026|gb|KPJ20566.1| (hypothetical protein RR46_00054, partial [Papilio xuthus])

HSP 1 Score: 99.7525 bits (247), Expect = 2.433e-26
Identity = 46/65 (70.77%), Postives = 54/65 (83.08%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            +DGRWG+KVLEWRPR G RSVGRPP RWTDDLVK+ G  W++ AQDR S +SLGEA+ QQW +YG
Sbjct:    1 SDGRWGRKVLEWRPRTGRRSVGRPPARWTDDLVKITGATWMQLAQDRLSWRSLGEAYAQQWVTYG 65          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 102.449 bits (254), Expect = 3.266e-26
Identity = 48/65 (73.85%), Postives = 54/65 (83.08%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
             DGRW ++VLEWRPR G RSVGRPP RWTDD+VK AG  W+RAA DR+  KSLGEA+VQQWTSYG
Sbjct:   96 TDGRWSRRVLEWRPRTGKRSVGRPPARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSYG 160          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 108.997 bits (271), Expect = 3.751e-26
Identity = 49/65 (75.38%), Postives = 57/65 (87.69%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
             DGRWG++VLEWRPR G RSVGRPP RWTDDLVKVAG  W+RAAQDR+  +S+GEA+VQQWT+YG
Sbjct:  706 TDGRWGRRVLEWRPRIGRRSVGRPPARWTDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTYG 770          
The following BLAST results are available for this feature:
BLAST of OSCA025964-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|3.724e-3086.15reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|8.450e-3086.15reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|9.669e-3086.15reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930681186|gb|KPJ20726.1|7.885e-2979.69hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|930648975|gb|KPI91323.1|2.457e-2878.13hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|930659181|gb|KPJ01280.1|1.766e-2776.19hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|930654247|gb|KPI96582.1|7.113e-2776.56hypothetical protein RR46_12612 [Papilio xuthus][more]
gi|930681026|gb|KPJ20566.1|2.433e-2670.77hypothetical protein RR46_00054, partial [Papilio ... [more]
gi|825740785|ref|WP_047149388.1|3.266e-2673.85hypothetical protein, partial [Escherichia coli][more]
gi|909577882|ref|XP_013144778.1|3.751e-2675.38PREDICTED: uncharacterized protein LOC106108224 [P... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_37235contignewscf_37235:843..1046 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025964-RAOSCA025964-RAOstrinia scapulalismRNAnewscf_37235 843..1046 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025964-PA ID=OSCA025964-PA|Name=OSCA025964-RA|organism=Ostrinia scapulalis|type=polypeptide|length=67bp
ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSR
KSLGEAFVQQWTSYGFS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity