OSCA025964-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025964-RA
Unique NameOSCA025964-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length67
Homology
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930655633|gb|KPI97961.1| (hypothetical protein RR46_11082 [Papilio xuthus])

HSP 1 Score: 99.7525 bits (247), Expect = 1.263e-25
Identity = 47/64 (73.44%), Postives = 56/64 (87.50%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            DGRWG+KVLEWRPR+G RSVGRPP  WT+DLVKVAG +W+R AQ+RSS +SLGEA+ QQW S+G
Sbjct:   61 DGRWGRKVLEWRPRSGRRSVGRPPAGWTNDLVKVAGASWMRVAQERSSWRSLGEAYAQQWASHG 124          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 104.375 bits (259), Expect = 1.351e-24
Identity = 47/64 (73.44%), Postives = 54/64 (84.38%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            DGRWG+K+LEWRPR G RSVGRPPTRWTDDLVK AG  W++ A DRS  KS+GEA+VQQWT+ G
Sbjct:  930 DGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKSAGSRWMQVAMDRSHWKSIGEAYVQQWTAIG 993          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 103.605 bits (257), Expect = 3.058e-24
Identity = 48/65 (73.85%), Postives = 54/65 (83.08%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
             DGRWGQKVLEWRPR G RSVGRPPTRW DDL++ AG  W++AAQDRS  + LGEA+VQQWTS G
Sbjct:  925 TDGRWGQKVLEWRPRTGRRSVGRPPTRWADDLLRFAGIRWMQAAQDRSLWRGLGEAYVQQWTSMG 989          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930657786|gb|KPJ00059.1| (hypothetical protein RR46_00281, partial [Papilio xuthus])

HSP 1 Score: 93.9745 bits (232), Expect = 4.776e-24
Identity = 45/61 (73.77%), Postives = 51/61 (83.61%), Query Frame = 0
Query:    5 WGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            WG+KVLEWRPR   RSVGRPP RWTDDLVKVAG +W+R AQDRSS +SLGEA+  QW S+G
Sbjct:    2 WGRKVLEWRPRTDRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYALQWASHG 62          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 93.9745 bits (232), Expect = 5.916e-24
Identity = 46/62 (74.19%), Postives = 52/62 (83.87%), Query Frame = 0
Query:    4 RWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            +WG+KVLEWRPR G RSVGRPP RWTDDLVKVAG  W+ AAQDRS  +S+GEA+VQQWT  G
Sbjct:   12 KWGRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGVHWMLAAQDRSLWQSMGEAYVQQWTISG 73          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930661989|gb|KPJ03810.1| (hypothetical protein RR46_01160 [Papilio xuthus])

HSP 1 Score: 93.2041 bits (230), Expect = 1.659e-23
Identity = 44/61 (72.13%), Postives = 50/61 (81.97%), Query Frame = 0
Query:    5 WGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            WG+KVLEWRPR   RSVGRPP RWTDDLVKV G +W+R AQDRSS +SLGEA+  QW S+G
Sbjct:   27 WGRKVLEWRPRTDRRSVGRPPARWTDDLVKVTGASWMRVAQDRSSWRSLGEAYALQWASHG 87          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930682111|gb|KPJ21651.1| (hypothetical protein RR48_00058 [Papilio machaon])

HSP 1 Score: 91.6633 bits (226), Expect = 4.048e-23
Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQW 61
            DGRWG+K+LEWRP  G RSVGRPP RWTDD VKVAG +W+R AQDRS  +SLGEA+ QQW
Sbjct:    9 DGRWGRKILEWRPCTGRRSVGRPPARWTDDQVKVAGVSWMRVAQDRSLWRSLGEAYAQQW 68          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|827560966|ref|XP_012551328.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101744003 [Bombyx mori])

HSP 1 Score: 100.138 bits (248), Expect = 4.928e-23
Identity = 45/60 (75.00%), Postives = 51/60 (85.00%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQW 61
            DGRWG+K+LEWRPR G RSVGRPPTRWTDDLVK AG  W++ A DRS  KS+GEA+VQQW
Sbjct:  443 DGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKSAGSRWMQVAMDRSHWKSIGEAYVQQW 502          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 99.7525 bits (247), Expect = 6.678e-23
Identity = 43/62 (69.35%), Postives = 52/62 (83.87%), Query Frame = 0
Query:    1 ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWT 62
            +DGRWG+K+LEWRPR G RSVGRPPTRWTDDLVK++G  W++ A DR    S+GEA+VQQWT
Sbjct:  929 SDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKISGSHWMQVATDRPHWTSVGEAYVQQWT 990          
BLAST of OSCA025964-RA vs. genbank:protein
Match: gi|930660085|gb|KPJ02084.1| (hypothetical protein RR46_01480 [Papilio xuthus])

HSP 1 Score: 89.7373 bits (221), Expect = 1.982e-22
Identity = 45/64 (70.31%), Postives = 52/64 (81.25%), Query Frame = 0
Query:    2 DGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSRKSLGEAFVQQWTSYG 65
            DGRWG+KVLEW PR   RSVGRPP RWTDDLVKVA  +W++  QDRSS +SLGEA+ QQW +YG
Sbjct:    2 DGRWGRKVLEWWPRTDRRSVGRPPARWTDDLVKVA--SWMQVTQDRSSWRSLGEAYAQQWATYG 63          
The following BLAST results are available for this feature:
BLAST of OSCA025964-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930655633|gb|KPI97961.1|1.263e-2573.44hypothetical protein RR46_11082 [Papilio xuthus][more]
gi|298204325|gb|ADI61811.1|1.351e-2473.44endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204337|gb|ADI61817.1|3.058e-2473.85endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930657786|gb|KPJ00059.1|4.776e-2473.77hypothetical protein RR46_00281, partial [Papilio ... [more]
gi|930681500|gb|KPJ21040.1|5.916e-2474.19hypothetical protein RR48_00071 [Papilio machaon][more]
gi|930661989|gb|KPJ03810.1|1.659e-2372.13hypothetical protein RR46_01160 [Papilio xuthus][more]
gi|930682111|gb|KPJ21651.1|4.048e-2373.33hypothetical protein RR48_00058 [Papilio machaon][more]
gi|827560966|ref|XP_012551328.1|4.928e-2375.00PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|298204327|gb|ADI61812.1|6.678e-2369.35endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930660085|gb|KPJ02084.1|1.982e-2270.31hypothetical protein RR46_01480 [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_37235contignewscf_37235:843..1046 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025964-RAOSCA025964-RAOstrinia scapulalismRNAnewscf_37235 843..1046 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025964-PA ID=OSCA025964-PA|Name=OSCA025964-RA|organism=Ostrinia scapulalis|type=polypeptide|length=67bp
ADGRWGQKVLEWRPRAGSRSVGRPPTRWTDDLVKVAGGAWIRAAQDRSSR
KSLGEAFVQQWTSYGFS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity