OSCA025965-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025965-RA
Unique NameOSCA025965-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length306
Homology
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|930653992|gb|KPI96327.1| (hypothetical protein RR46_12357 [Papilio xuthus])

HSP 1 Score: 408.683 bits (1049), Expect = 1.336e-136
Identity = 232/323 (71.83%), Postives = 262/323 (81.11%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGDDYKKK---SSPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTSPKR----------NDSEEKDGLS---ETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSEEDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIKA 306
            MTVTKLP N+ RLS KTSVEQYLSQLK+CENG+ GYTK + K+D+ VPVHLPY EKNGL+HRWE+GSSSSRSNSNSDLSISKTISEP SLAKP +D  +MS S T+KLPS+RLASIK QLDPNNPIGKILEKSTVI V NGD  +KK    SP+V   KESLKNDIEKQVKAPKHTSNFAS+IQISQPIAS TS  +          ND   +  L+   ET +S+V LKYIDSE +DRL  + ++ESPSGTGFENKTFEHEN LKKR+ K  ++KE  EDGVKSMETSTEST SEPTEDSSPETPS+R++ILD KDYEDIKA
Sbjct:  257 MTVTKLPTNDSRLSAKTSVEQYLSQLKECENGSSGYTKAVSKEDQPVPVHLPYVEKNGLSHRWEIGSSSSRSNSNSDLSISKTISEPVSLAKPKIDNTNMSISFTAKLPSERLASIKCQLDPNNPIGKILEKSTVIQVSNGDIERKKLARCSPEV-KVKESLKNDIEKQVKAPKHTSNFASYIQISQPIASGTSTPKISKQIDLNNINDELTQAELTIKPETKKSKVNLKYIDSELEDRLALE-EVESPSGTGFENKTFEHENYLKKRSEKEVDEKEP-EDGVKSMETSTESTISEPTEDSSPETPSSRRRILDIKDYEDIKA 576          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|913328307|ref|XP_013195657.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 17-like isoform X1 [Amyelois transitella])

HSP 1 Score: 416.001 bits (1068), Expect = 1.327e-135
Identity = 236/310 (76.13%), Postives = 265/310 (85.48%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDK-NSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGDDYKKKSSPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTS-PKRNDSEEKDGLS-ETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSEEDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIKA 306
            MTVTKLP N+ R + K SVEQYL+QLKDCENGTVGYTK L KD+K VPVHLPYA+KNG+NHRWEVGSSSSRSNSNSDLSISKTISEP SLAKPVVDK N MSTSLT+KLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD  K++ +P     K+ +K DIEKQVK PKHTSNFAS+IQISQPIA+ TS PKR  +   D  + E  RS+VKLKYIDS +D  LV DNDIESPSGTGFENKTFEHEN LKKRT KSEE+K   +DGVKSMETS+ESTFSE TEDSS +TPS+R+++LD+KDY+DIK+
Sbjct:  253 MTVTKLPTNDTRYT-KPSVEQYLNQLKDCENGTVGYTKILAKDEKPVPVHLPYADKNGVNHRWEVGSSSSRSNSNSDLSISKTISEPVSLAKPVVDKTNPMSTSLTTKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGDVDKREVTP-----KKDIKTDIEKQVKTPKHTSNFASYIQISQPIATGTSTPKREVNNVNDDTNDEPRRSKVKLKYIDSAEDS-LVLDNDIESPSGTGFENKTFEHENFLKKRTEKSEEEK-GQDDGVKSMETSSESTFSEATEDSSTDTPSSRRRVLDAKDYDDIKS 554          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|910345574|ref|XP_013176656.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 2-like [Papilio xuthus] >gi|910345576|ref|XP_013176657.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 2-like [Papilio xuthus])

HSP 1 Score: 406.757 bits (1044), Expect = 6.708e-132
Identity = 232/323 (71.83%), Postives = 262/323 (81.11%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGDDYKKK---SSPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTSPKR----------NDSEEKDGLS---ETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSEEDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIKA 306
            MTVTKLP N+ RLS KTSVEQYLSQLK+CENG+ GYTK + K+D+ VPVHLPY EKNGL+HRWE+GSSSSRSNSNSDLSISKTISEP SLAKP +D  +MS S T+KLPS+RLASIK QLDPNNPIGKILEKSTVI V NGD  +KK    SP+V   KESLKNDIEKQVKAPKHTSNFAS+IQISQPIAS TS  +          ND   +  L+   ET +S+V LKYIDSE +DRL  + ++ESPSGTGFENKTFEHEN LKKR+ K  ++KE  EDGVKSMETSTEST SEPTEDSSPETPS+R++ILD KDYEDIKA
Sbjct:  257 MTVTKLPTNDSRLSAKTSVEQYLSQLKECENGSSGYTKAVSKEDQPVPVHLPYVEKNGLSHRWEIGSSSSRSNSNSDLSISKTISEPVSLAKPKIDNTNMSISFTAKLPSERLASIKCQLDPNNPIGKILEKSTVIQVSNGDIERKKLARCSPEV-KVKESLKNDIEKQVKAPKHTSNFASYIQISQPIASGTSTPKISKQIDLNNINDELTQAELTIKPETKKSKVNLKYIDSELEDRLALE-EVESPSGTGFENKTFEHENYLKKRSEKEVDEKEP-EDGVKSMETSTESTISEPTEDSSPETPSSRRRILDIKDYEDIKA 576          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|943943615|ref|XP_014355240.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 4-like [Papilio machaon])

HSP 1 Score: 400.208 bits (1027), Expect = 2.476e-130
Identity = 231/327 (70.64%), Postives = 264/327 (80.73%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD----DYKK--KSSPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTSPKR-----------NDSEEKDGLS---ETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSEEDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIKA 306
            MTVTKLPAN+ RLS KTSVEQYLSQLK+CENG+ GYTK + K+D+ VPVHLPY EKNG++HRWEVGSS+SRSNSNSDL+ISKTISEP SLAKP  D  +MS S T+KLPS+RLASIKSQLDPNNPIGKILEKSTVI V NGD    + KK  +SSP+V   KESLKNDIEKQVKAPKHTSNFAS+IQISQP+AS TS  +           ND   +  L+   E  +S+V LKYIDSE +DRL  + ++ESPSGTGFENKTFEHEN LKKR+ K  ++KE  EDGVKSMETSTEST SEPTEDSSPETPS+R++ILD KDYEDIKA
Sbjct:  257 MTVTKLPANDSRLSAKTSVEQYLSQLKECENGSGGYTKAVSKEDQPVPVHLPYVEKNGISHRWEVGSSNSRSNSNSDLTISKTISEPVSLAKPKPDNTNMSISFTAKLPSERLASIKSQLDPNNPIGKILEKSTVIQVANGDIDNTERKKLPRSSPEV-KVKESLKNDIEKQVKAPKHTSNFASYIQISQPVASGTSTPKISRQIDVNNIINDELTQAELTIKPEPKKSKVNLKYIDSEHEDRLALE-EVESPSGTGFENKTFEHENYLKKRSEKELDEKEP-EDGVKSMETSTESTISEPTEDSSPETPSSRRRILDIKDYEDIKA 580          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|930677327|gb|KPJ17412.1| (Ubiquitin carboxyl-terminal hydrolase 2 [Papilio machaon])

HSP 1 Score: 400.593 bits (1028), Expect = 2.769e-130
Identity = 231/327 (70.64%), Postives = 264/327 (80.73%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD----DYKK--KSSPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTSPKR-----------NDSEEKDGLS---ETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSEEDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIKA 306
            MTVTKLPAN+ RLS KTSVEQYLSQLK+CENG+ GYTK + K+D+ VPVHLPY EKNG++HRWEVGSS+SRSNSNSDL+ISKTISEP SLAKP  D  +MS S T+KLPS+RLASIKSQLDPNNPIGKILEKSTVI V NGD    + KK  +SSP+V   KESLKNDIEKQVKAPKHTSNFAS+IQISQP+AS TS  +           ND   +  L+   E  +S+V LKYIDSE +DRL  + ++ESPSGTGFENKTFEHEN LKKR+ K  ++KE  EDGVKSMETSTEST SEPTEDSSPETPS+R++ILD KDYEDIKA
Sbjct:  257 MTVTKLPANDSRLSAKTSVEQYLSQLKECENGSGGYTKAVSKEDQPVPVHLPYVEKNGISHRWEVGSSNSRSNSNSDLTISKTISEPVSLAKPKPDNTNMSISFTAKLPSERLASIKSQLDPNNPIGKILEKSTVIQVANGDIDNTERKKLPRSSPEV-KVKESLKNDIEKQVKAPKHTSNFASYIQISQPVASGTSTPKISRQIDVNNIINDELTQAELTIKPEPKKSKVNLKYIDSEHEDRLALE-EVESPSGTGFENKTFEHENYLKKRSEKELDEKEP-EDGVKSMETSTESTISEPTEDSSPETPSSRRRILDIKDYEDIKA 580          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|909575488|ref|XP_013143481.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 4-like [Papilio polytes] >gi|909575490|ref|XP_013143482.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 4-like [Papilio polytes])

HSP 1 Score: 391.734 bits (1005), Expect = 4.020e-126
Identity = 230/327 (70.34%), Postives = 262/327 (80.12%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD------DYKKKSSPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTSPKR-----------NDSEEKDGLS---ETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSEEDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIKA 306
            MTVTKLPAN+ R+S K SVEQYLSQLK+CENG+ GYTK + K+D+ VPVHLPY EKNG++HRWEVGSSSSRSNSNSD+SISKTISEP SLAKP VD  +MS S T+KLPS+RLASIKSQLDPNNPIGKILEKSTVI V NGD      +   +SSP+V   KESLKNDIEKQVK PKHTSNFAS+IQISQPIAS TS  +           ND   +  L+   E  +S+V LKYIDSEQ+DRL  + ++ESPSGTGFENKTFEHEN LKKR+ K  ++KE  EDGVKSMETSTEST SEPTEDSSPETPS+R++ILD KDYEDIKA
Sbjct:  256 MTVTKLPANDTRISAKKSVEQYLSQLKECENGSSGYTKAVSKEDQPVPVHLPYVEKNGISHRWEVGSSSSRSNSNSDISISKTISEPVSLAKPKVDNTTMSISFTAKLPSERLASIKSQLDPNNPIGKILEKSTVIQVANGDIDNTERNKLARSSPEV-KVKESLKNDIEKQVKVPKHTSNFASYIQISQPIASGTSTPKISKQTDMNNIINDELTQAELTIKPELKKSKVNLKYIDSEQEDRLALE-EVESPSGTGFENKTFEHENYLKKRSEKDVDEKEL-EDGVKSMETSTESTISEPTEDSSPETPSSRRRILDIKDYEDIKA 579          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|357604445|gb|EHJ64192.1| (putative ubiquitin specific protease 41 [Danaus plexippus])

HSP 1 Score: 373.244 bits (957), Expect = 2.256e-119
Identity = 214/313 (68.37%), Postives = 254/313 (81.15%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTKL-PKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNSM-STSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD-DYKKKS----SPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTSPKRNDSEEKDGLSETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSE-EDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIK 305
            MTVTKLPAN+ R +   ++E YL+QLKDCENG VGY K  PKD+K VP+HLPYA+KNG+N R+E GS +SR++SNSDL+ISKT+SEP SLAK  VDKN+M S+SLT+KLPS+RLASIKSQLDPNNPIGKILEKSTVI VENGD DY +++    SP+V  K + LKNDIEKQ K PKHT+NFAS+IQISQP+AS  +PK++    +D   E    R  +KYIDSE+ DRLV +NDIESPSGTGFENKTFEHEN +KKRT K+E EDK   EDG+KSMETSTEST SE TEDSSPETPSAR+ +LD KDY+ IK
Sbjct:  247 MTVTKLPANDVRYT--KTMEHYLNQLKDCENG-VGYAKTNPKDEKPVPIHLPYADKNGVN-RYE-GSPTSRNSSNSDLTISKTLSEPVSLAKTSVDKNNMMSSSLTTKLPSERLASIKSQLDPNNPIGKILEKSTVIQVENGDADYNERNRIRYSPEV--KIKELKNDIEKQTKTPKHTTNFASYIQISQPVASGATPKKHLDANEDAKKE----RKSIKYIDSEE-DRLVLENDIESPSGTGFENKTFEHENFIKKRTEKNETEDK---EDGIKSMETSTESTISESTEDSSPETPSARRNLLDLKDYDYIK 544          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|914570545|gb|KOB73891.1| (Ubiquitin carboxyl-terminal hydrolase, partial [Operophtera brumata])

HSP 1 Score: 367.466 bits (942), Expect = 1.731e-118
Identity = 222/318 (69.81%), Postives = 258/318 (81.13%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTKLPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNS-MSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD-DYKK-KSSPDVLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTS-PKR------NDSEEKDGLSETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSEEDKE--ATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDIKA 306
            MTVTKLPAN+ R   K SVEQY++QLKDCENGT  YTKL K+DK+VP+HLPY EKNG + +WE GSSSSRSNSNSD+SISKTISEP SL+KPVV++NS M+ SLT+KLPSDRLASIKSQLDPNNPIGKILEKSTVI VENGD DYKK +SSP++   KE LKN+IEKQVKAPKHTSNFAS+IQISQP+AS  S PK       N+    + L    +S+V +KYID+  +D+ + DNDIESPSGTGFENKTFEHEN LKKRT ++EE  E    ED VKSMETSTEST SEP+ED SPETPSAR+++LD KDY+D K 
Sbjct:  252 MTVTKLPANDLRYM-KASVEQYINQLKDCENGTSEYTKLSKEDKLVPIHLPYLEKNGTS-KWESGSSSSRSNSNSDISISKTISEPVSLSKPVVERNSAMTMSLTAKLPSDRLASIKSQLDPNNPIGKILEKSTVITVENGDSDYKKLRSSPEISKSKELLKNEIEKQVKAPKHTSNFASYIQISQPVASGASTPKTKLENIINEEATINDLKPERKSKVSIKYIDA--NDKAILDNDIESPSGTGFENKTFEHENFLKKRTERNEESNENHRGEDEVKSMETSTESTISEPSEDLSPETPSARRRLLD-KDYDDSKG 564          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|768411824|ref|XP_011565871.1| (PREDICTED: uncharacterized protein LOC105395608 [Plutella xylostella])

HSP 1 Score: 357.451 bits (916), Expect = 1.316e-112
Identity = 217/329 (65.96%), Postives = 259/329 (78.72%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDK-NSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD-DYKKK----SSPDVL--SKKESLKNDIEKQ-VKAPKHTSNFASFIQISQPIAS-STSPKRN--------DSEEKDGLSETGRSRVKLKYIDSEQDD-RLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSE-EDKEATEDG----VKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDI 304
            MTVTKLPANE + S KT+V+QYL+QLK+CENGT GYTK LPKD++ VPVH P  EKNG+ H+WEVGSSSSRSNSNSDLSISKT+SEP SLA+PVV+K N MS S  +KLPSDRLASIKSQLDPNNPIGKILEKSTVI VENGD D K++     SP+V   SKKESLKNDIEKQ +K PKHTSNFAS+IQISQP+AS S++PK          D + K    E+ +SR ++KYIDSE DD R + DN++ESPSGTGFENKTFEHEN LKKR+   E ++K+   +G    +K METSTEST S+P ED SP++PS+R+K L+ KDY+DI
Sbjct:  264 MTVTKLPANESKYSSKTAVDQYLTQLKNCENGTSGYTKILPKDEQPVPVHQPSVEKNGIGHKWEVGSSSSRSNSNSDLSISKTLSEPVSLARPVVEKSNDMSVSFNAKLPSDRLASIKSQLDPNNPIGKILEKSTVIQVENGDADAKERKRLSRSPEVTVNSKKESLKNDIEKQGIKTPKHTSNFASYIQISQPVASGSSTPKTRLIEVTTSIDEDPKPEPKESQKSRNRIKYIDSETDDSRDLLDNEVESPSGTGFENKTFEHENYLKKRSEDLEVKEKDLQTNGDEVDLKPMETSTESTISDPAEDLSPDSPSSRRK-LNIKDYDDI 591          
BLAST of OSCA025965-RA vs. genbank:protein
Match: gi|768410584|ref|XP_011559094.1| (PREDICTED: ubiquitin carboxyl-terminal hydrolase 37-like [Plutella xylostella])

HSP 1 Score: 355.91 bits (912), Expect = 1.962e-112
Identity = 216/329 (65.65%), Postives = 259/329 (78.72%), Query Frame = 0
Query:    1 MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTK-LPKDDKIVPVHLPYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDK-NSMSTSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGD-DYKKK----SSPDVL--SKKESLKNDIEKQ-VKAPKHTSNFASFIQISQPIAS-STSPKRN--------DSEEKDGLSETGRSRVKLKYIDSEQDD-RLVXDNDIESPSGTGFENKTFEHENXLKKRTXKSE-EDKEATEDG----VKSMETSTESTFSEPTEDSSPETPSARKKILDSKDYEDI 304
            MTVTKLPANE + S KT+V+QYL+QLK+CENGT GYTK LPK+++ VPVH P  EKNG+ H+WEVGSSSSRSNSNSDLSISKT+SEP SLA+PVV+K N MS S  +KLPSDRLASIKSQLDPNNPIGKILEKSTVI VENGD D K++     SP+V   SKKESLKNDIEKQ +K PKHTSNFAS+IQISQP+AS S++PK          D + K    E+ +SR ++KYIDSE DD R + DN++ESPSGTGFENKTFEHEN LKKR+   E ++K+   +G    +K METSTEST S+P ED SP++PS+R+K L+ KDY+DI
Sbjct:  264 MTVTKLPANESKYSSKTAVDQYLTQLKNCENGTSGYTKILPKEEQPVPVHQPSVEKNGIGHKWEVGSSSSRSNSNSDLSISKTLSEPVSLARPVVEKSNDMSVSFNAKLPSDRLASIKSQLDPNNPIGKILEKSTVIQVENGDADAKERKRLSRSPEVTVNSKKESLKNDIEKQGIKTPKHTSNFASYIQISQPVASGSSTPKTRLIEVTTSIDEDPKPEPKESQKSRNRIKYIDSETDDSRDLLDNEVESPSGTGFENKTFEHENYLKKRSEDLEVKEKDLQTNGDEVDLKPMETSTESTISDPAEDLSPDSPSSRRK-LNIKDYDDI 591          
The following BLAST results are available for this feature:
BLAST of OSCA025965-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|930653992|gb|KPI96327.1|1.336e-13671.83hypothetical protein RR46_12357 [Papilio xuthus][more]
gi|913328307|ref|XP_013195657.1|1.327e-13576.13PREDICTED: ubiquitin carboxyl-terminal hydrolase 1... [more]
gi|910345574|ref|XP_013176656.1|6.708e-13271.83PREDICTED: ubiquitin carboxyl-terminal hydrolase 2... [more]
gi|943943615|ref|XP_014355240.1|2.476e-13070.64PREDICTED: ubiquitin carboxyl-terminal hydrolase 4... [more]
gi|930677327|gb|KPJ17412.1|2.769e-13070.64Ubiquitin carboxyl-terminal hydrolase 2 [Papilio m... [more]
gi|909575488|ref|XP_013143481.1|4.020e-12670.34PREDICTED: ubiquitin carboxyl-terminal hydrolase 4... [more]
gi|357604445|gb|EHJ64192.1|2.256e-11968.37putative ubiquitin specific protease 41 [Danaus pl... [more]
gi|914570545|gb|KOB73891.1|1.731e-11869.81Ubiquitin carboxyl-terminal hydrolase, partial [Op... [more]
gi|768411824|ref|XP_011565871.1|1.316e-11265.96PREDICTED: uncharacterized protein LOC105395608 [P... [more]
gi|768410584|ref|XP_011559094.1|1.962e-11265.65PREDICTED: ubiquitin carboxyl-terminal hydrolase 3... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016579 protein deubiquitination
biological_process GO:0006511 ubiquitin-dependent protein catabolic process
molecular_function GO:0036459 thiol-dependent ubiquitinyl hydrolase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_10586contignewscf_10586:2800..3717 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025965-RAOSCA025965-RAOstrinia scapulalismRNAnewscf_10586 2800..3717 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025965-PA ID=OSCA025965-PA|Name=OSCA025965-RA|organism=Ostrinia scapulalis|type=polypeptide|length=306bp
MTVTKLPANEPRLSPKTSVEQYLSQLKDCENGTVGYTKLPKDDKIVPVHL
PYAEKNGLNHRWEVGSSSSRSNSNSDLSISKTISEPXSLAKPVVDKNSMS
TSLTSKLPSDRLASIKSQLDPNNPIGKILEKSTVIHVENGDDYKKKSSPD
VLSKKESLKNDIEKQVKAPKHTSNFASFIQISQPIASSTSPKRNDSEEKD
GLSETGRSRVKLKYIDSEQDDRLVXDNDIESPSGTGFENKTFEHENXLKK
RTXKSEEDKEATEDGVKSMETSTESTFSEPTEDSSPETPSARKKILDSKD
YEDIKA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0016579protein deubiquitination
Vocabulary: Molecular Function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity