OSCA025967-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025967-RA
Unique NameOSCA025967-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length137
Homology
BLAST of OSCA025967-RA vs. genbank:protein
Match: gi|512935605|ref|XP_004933314.1| (PREDICTED: uncharacterized protein LOC101739238 [Bombyx mori])

HSP 1 Score: 68.5514 bits (166), Expect = 1.765e-12
Identity = 35/43 (81.40%), Postives = 36/43 (83.72%), Query Frame = 0
Query:    7 PATF-RSSVHVVGGLPTLRFPARGRHSRTFLPHRPSSLRAMCP 48
            PA F RSSVH+VGG PTLR P RGRHSR FLPHRPSSLRAM P
Sbjct:   63 PALFIRSSVHLVGGRPTLRLPVRGRHSRIFLPHRPSSLRAMWP 105          
The following BLAST results are available for this feature:
BLAST of OSCA025967-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|512935605|ref|XP_004933314.1|1.765e-1281.40PREDICTED: uncharacterized protein LOC101739238 [B... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_7879contignewscf_7879:5964..6377 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025967-RAOSCA025967-RAOstrinia scapulalismRNAnewscf_7879 5964..6377 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025967-PA ID=OSCA025967-PA|Name=OSCA025967-RA|organism=Ostrinia scapulalis|type=polypeptide|length=137bp
MSQKALPATFRSSVHVVGGLPTLRFPARGRHSRTFLPHRPSSLRAMCPAH
CHLILAILRAMSVTLVLLRISCDVGSAGPFIVENLGGDLCPAVDLIWQKT
KERRNEPKVKLHCKGSFPLQSSFAVSRLQDASNWTVV
back to top