OSCA025968-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025968-RA
Unique NameOSCA025968-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length58
Homology
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|943940008|ref|XP_014371557.1| (PREDICTED: charged multivesicular body protein 4b [Papilio machaon] >gi|930678560|gb|KPJ18492.1| Charged multivesicular body protein 4b [Papilio machaon])

HSP 1 Score: 116.316 bits (290), Expect = 3.736e-31
Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|930657552|gb|KPI99856.1| (Charged multivesicular body protein 4b [Papilio xuthus])

HSP 1 Score: 111.694 bits (278), Expect = 1.375e-30
Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTMK+AANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMKEAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|357612367|gb|EHJ67943.1| (hypothetical protein KGM_19860 [Danaus plexippus])

HSP 1 Score: 114.39 bits (285), Expect = 1.883e-30
Identity = 57/58 (98.28%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTMKDAANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMKDAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|913312096|ref|XP_013186758.1| (PREDICTED: charged multivesicular body protein 4b [Amyelois transitella])

HSP 1 Score: 113.235 bits (282), Expect = 5.716e-30
Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTM+DAANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMRDAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|1171813747|gb|ARD08867.1| (charged multivesicular body protein 4 [Spodoptera frugiperda])

HSP 1 Score: 113.235 bits (282), Expect = 6.387e-30
Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTM+DAANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMRDAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|509164027|gb|JAA80134.1| (shrub [Pararge aegeria])

HSP 1 Score: 112.464 bits (280), Expect = 1.085e-29
Identity = 56/58 (96.55%), Postives = 56/58 (96.55%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQL QIDGTLTQIEAQREALEGA TNAQVLNTMKDAANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLNQIDGTLTQIEAQREALEGANTNAQVLNTMKDAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|930664588|gb|KPJ05848.1| (Charged multivesicular body protein 4b [Papilio xuthus])

HSP 1 Score: 111.309 bits (277), Expect = 1.276e-29
Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTMK+AANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMKEAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|910330701|ref|XP_013168657.1| (PREDICTED: charged multivesicular body protein 4b [Papilio xuthus] >gi|930662144|gb|KPJ03941.1| Charged multivesicular body protein 4b [Papilio xuthus])

HSP 1 Score: 112.079 bits (279), Expect = 1.805e-29
Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTMK+AANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMKEAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|512894601|ref|XP_004923469.1| (PREDICTED: charged multivesicular body protein 4b [Bombyx mori])

HSP 1 Score: 111.309 bits (277), Expect = 3.850e-29
Identity = 55/58 (94.83%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTM++AANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMREAANAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|909582282|ref|XP_013147164.1| (PREDICTED: charged multivesicular body protein 4b [Papilio polytes])

HSP 1 Score: 110.923 bits (276), Expect = 5.325e-29
Identity = 55/58 (94.83%), Postives = 57/58 (98.28%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGA TNAQVLNTM++AANAMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGANTNAQVLNTMREAANAMKLAHKD 119          
The following BLAST results are available for this feature:
BLAST of OSCA025968-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943940008|ref|XP_014371557.1|3.736e-31100.00PREDICTED: charged multivesicular body protein 4b ... [more]
gi|930657552|gb|KPI99856.1|1.375e-3096.55Charged multivesicular body protein 4b [Papilio xu... [more]
gi|357612367|gb|EHJ67943.1|1.883e-3098.28hypothetical protein KGM_19860 [Danaus plexippus][more]
gi|913312096|ref|XP_013186758.1|5.716e-3096.55PREDICTED: charged multivesicular body protein 4b ... [more]
gi|1171813747|gb|ARD08867.1|6.387e-3096.55charged multivesicular body protein 4 [Spodoptera ... [more]
gi|509164027|gb|JAA80134.1|1.085e-2996.55shrub [Pararge aegeria][more]
gi|930664588|gb|KPJ05848.1|1.276e-2996.55Charged multivesicular body protein 4b [Papilio xu... [more]
gi|910330701|ref|XP_013168657.1|1.805e-2996.55PREDICTED: charged multivesicular body protein 4b ... [more]
gi|512894601|ref|XP_004923469.1|3.850e-2994.83PREDICTED: charged multivesicular body protein 4b ... [more]
gi|909582282|ref|XP_013147164.1|5.325e-2994.83PREDICTED: charged multivesicular body protein 4b ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007034 vacuolar transport
cellular_component GO:0005622 intracellular
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 8..29
NoneNo IPR availablePANTHERPTHR22761:SF14CHARGED MULTIVESICULAR BODY PROTEIN 4Acoord: 1..58
NoneNo IPR availablePANTHERPTHR22761SNF7 - RELATEDcoord: 1..58
IPR005024Snf7 familyPFAMPF03357Snf7coord: 1..57
e-value: 7.0E-16
score: 57.9

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_46155contignewscf_46155:786..959 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025968-RAOSCA025968-RAOstrinia scapulalismRNAnewscf_46155 786..959 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025968-PA ID=OSCA025968-PA|Name=OSCA025968-RA|organism=Ostrinia scapulalis|type=polypeptide|length=58bp
AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAAN
AMKLAHKD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Biological Process
TermDefinition
GO:0007034vacuolar transport
Vocabulary: INTERPRO
TermDefinition
IPR005024Snf7_fam