OSCA025968-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025968-RA
Unique NameOSCA025968-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length58
Homology
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|768426331|ref|XP_011554206.1| (PREDICTED: charged multivesicular body protein 4b-like [Plutella xylostella] >gi|768450229|ref|XP_011567243.1| PREDICTED: charged multivesicular body protein 4b-like [Plutella xylostella])

HSP 1 Score: 103.219 bits (256), Expect = 5.527e-26
Identity = 51/58 (87.93%), Postives = 54/58 (93.10%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AIAALKRKKRYEKQLTQIDGTL+QIE QREALEGA TN QVLNTM++AA AMKLAHKD
Sbjct:   62 AIAALKRKKRYEKQLTQIDGTLSQIEMQREALEGANTNTQVLNTMREAAAAMKLAHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119593|gb|AKW46301.1| (Snf7 superfamily protein, partial [Simulium chromatinum])

HSP 1 Score: 85.8853 bits (211), Expect = 8.015e-21
Identity = 44/58 (75.86%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TN  VL TMK A+NA+K AHKD
Sbjct:    8 AIQALKRKKRYEKQLQQIDGTLSTIEMQREALENANTNTAVLQTMKSASNALKAAHKD 65          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119563|gb|AKW46286.1| (Snf7 superfamily protein, partial [Simulium brevicercum])

HSP 1 Score: 85.5001 bits (210), Expect = 1.020e-20
Identity = 44/58 (75.86%), Postives = 48/58 (82.76%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TNA VL TMK A++A+K AHKD
Sbjct:    8 AIQALKRKKRYEKQLQQIDGTLSTIEMQREALENANTNAAVLQTMKSASDALKAAHKD 65          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119567|gb|AKW46288.1| (Snf7 superfamily protein, partial [Simulium brevicercum])

HSP 1 Score: 85.1149 bits (209), Expect = 1.672e-20
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TN  VL TMK A++A+K AHKD
Sbjct:    8 AIRALKRKKRYEKQLQQIDGTLSTIEMQREALENANTNTAVLQTMKSASBALKAAHKD 65          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|668456236|gb|KFB44423.1| (AGAP005316-PA-like protein [Anopheles sinensis])

HSP 1 Score: 88.9669 bits (219), Expect = 1.697e-20
Identity = 44/58 (75.86%), Postives = 50/58 (86.21%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TNA+VL TMK+AA+A+K+ HKD
Sbjct:   62 AIQALKRKKRYEKQLQQIDGTLSTIEMQREALENANTNAEVLKTMKNAADALKVTHKD 119          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119499|gb|AKW46254.1| (Snf7 superfamily protein, partial [Simulium arcticum])

HSP 1 Score: 84.3445 bits (207), Expect = 2.565e-20
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TN  VL TMK A++A+K AHKD
Sbjct:    8 AIQALKRKKRYEKQLQQIDGTLSSIEMQREALENANTNTAVLQTMKSASDALKAAHKD 65          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119495|gb|AKW46252.1| (Snf7 superfamily protein, partial [Simulium arcticum] >gi|915119511|gb|AKW46260.1| Snf7 superfamily protein, partial [Simulium brevicercum])

HSP 1 Score: 84.3445 bits (207), Expect = 3.337e-20
Identity = 43/58 (74.14%), Postives = 46/58 (79.31%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TN  VL TMK A+N +K AHKD
Sbjct:    8 AIQALKRKKRYEKQLQQIDGTLSTIEMQREALENANTNTAVLQTMKSASNTLKAAHKD 65          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119465|gb|AKW46237.1| (Snf7 superfamily protein, partial [Simulium arcticum])

HSP 1 Score: 83.9593 bits (206), Expect = 3.891e-20
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TN  VL TMK A++A+K AHKD
Sbjct:    8 AIQALKRKKRYEKQLQQIDGTLSTIEMQREALENANTNTAVLQTMKSASDALKAAHKD 65          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119621|gb|AKW46315.1| (Snf7 superfamily protein, partial [Simulium chromatinum])

HSP 1 Score: 83.9593 bits (206), Expect = 4.110e-20
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREALE A TN  VL TMK A++A+K AHKD
Sbjct:    8 AIQALKRKKRYEKQLQQIDGTLSTIEMQREALENANTNTAVLQTMKSASDALKAAHKD 65          
BLAST of OSCA025968-RA vs. genbank:protein
Match: gi|915119677|gb|AKW46343.1| (Snf7 superfamily protein, partial [Simulium defoliarti])

HSP 1 Score: 83.9593 bits (206), Expect = 4.537e-20
Identity = 43/58 (74.14%), Postives = 47/58 (81.03%), Query Frame = 0
Query:    1 AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAANAMKLAHKD 58
            AI ALKRKKRYEKQL QIDGTL+ IE QREAL+ A TN  VL TMK A+NA+K AHKD
Sbjct:    8 AIQALKRKKRYEKQLQQIDGTLSTIEMQREALKNANTNTAVLQTMKSASNALKAAHKD 65          
The following BLAST results are available for this feature:
BLAST of OSCA025968-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|768426331|ref|XP_011554206.1|5.527e-2687.93PREDICTED: charged multivesicular body protein 4b-... [more]
gi|915119593|gb|AKW46301.1|8.015e-2175.86Snf7 superfamily protein, partial [Simulium chroma... [more]
gi|915119563|gb|AKW46286.1|1.020e-2075.86Snf7 superfamily protein, partial [Simulium brevic... [more]
gi|915119567|gb|AKW46288.1|1.672e-2074.14Snf7 superfamily protein, partial [Simulium brevic... [more]
gi|668456236|gb|KFB44423.1|1.697e-2075.86AGAP005316-PA-like protein [Anopheles sinensis][more]
gi|915119499|gb|AKW46254.1|2.565e-2074.14Snf7 superfamily protein, partial [Simulium arctic... [more]
gi|915119495|gb|AKW46252.1|3.337e-2074.14Snf7 superfamily protein, partial [Simulium arctic... [more]
gi|915119465|gb|AKW46237.1|3.891e-2074.14Snf7 superfamily protein, partial [Simulium arctic... [more]
gi|915119621|gb|AKW46315.1|4.110e-2074.14Snf7 superfamily protein, partial [Simulium chroma... [more]
gi|915119677|gb|AKW46343.1|4.537e-2074.14Snf7 superfamily protein, partial [Simulium defoli... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007034 vacuolar transport
cellular_component GO:0005622 intracellular
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 8..29
NoneNo IPR availablePANTHERPTHR22761:SF14CHARGED MULTIVESICULAR BODY PROTEIN 4Acoord: 1..58
NoneNo IPR availablePANTHERPTHR22761SNF7 - RELATEDcoord: 1..58
IPR005024Snf7 familyPFAMPF03357Snf7coord: 1..57
e-value: 7.0E-16
score: 57.9

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_46155contignewscf_46155:786..959 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025968-RAOSCA025968-RAOstrinia scapulalismRNAnewscf_46155 786..959 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025968-PA ID=OSCA025968-PA|Name=OSCA025968-RA|organism=Ostrinia scapulalis|type=polypeptide|length=58bp
AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAAN
AMKLAHKD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Biological Process
TermDefinition
GO:0007034vacuolar transport
Vocabulary: INTERPRO
TermDefinition
IPR005024Snf7_fam