OSCA025969-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025969-RA
Unique NameOSCA025969-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length115
Homology
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|913328148|ref|XP_013195567.1| (PREDICTED: uncharacterized protein LOC106138830 [Amyelois transitella])

HSP 1 Score: 170.629 bits (431), Expect = 5.466e-47
Identity = 97/113 (85.84%), Postives = 104/113 (92.04%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKR 113
            AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDF +FEMP+TN+KS KKH+KCNKQ MRKS+TPVH  F  SNSSDPLKNLTFHFEEV+AL KSNSCDVDTLT RK+
Sbjct:  675 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFTDFEMPITNAKSTKKHMKCNKQ-MRKSMTPVHMNF--SNSSDPLKNLTFHFEEVTALAKSNSCDVDTLTRRKK 784          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|509172675|gb|JAA84458.1| (Uncharacterized protein, partial [Pararge aegeria])

HSP 1 Score: 153.68 bits (387), Expect = 1.545e-45
Identity = 87/114 (76.32%), Postives = 97/114 (85.09%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRK 114
             VKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDF EFEMP+TN+KS KKH     +  R +LTPVH  F+KSNSSDPLKNL+F FEEV+ + KSNSCDVDTLT RK++
Sbjct:   10 VVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFNEFEMPITNAKSCKKH---KSKLFRNTLTPVHGPFIKSNSSDPLKNLSFQFEEVAIMAKSNSCDVDTLTRRKKR 120          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|1073542223|gb|JAT88223.1| (hypothetical protein g.11883, partial [Pectinophora gossypiella])

HSP 1 Score: 162.54 bits (410), Expect = 7.890e-45
Identity = 93/114 (81.58%), Postives = 104/114 (91.23%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRK 114
            AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHH+GD  +FEMP+TNSKS KKH+K +KQ +R+SLTPVH+ FVKS+SSDPLKNLTFHFEE   LTKSNSCDVDTLT RK++
Sbjct:  431 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHRGDLNDFEMPITNSKSCKKHLKASKQ-IRQSLTPVHTPFVKSSSSDPLKNLTFHFEE---LTKSNSCDVDTLTRRKKR 540          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|768422693|ref|XP_011552217.1| (PREDICTED: uncharacterized protein LOC105383801 [Plutella xylostella])

HSP 1 Score: 157.532 bits (397), Expect = 2.418e-42
Identity = 89/114 (78.07%), Postives = 104/114 (91.23%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRK 114
            +VKIRRSSSVPSK+DKNRDSSSSNDSGVSTGSLKHHK DF EFEMPVT++KS KKH+KC+KQ MR SLTP  + F+K++SSDP+KNLTFHFEEV+ +TKSNSCDVDTLT RK++
Sbjct:  657 SVKIRRSSSVPSKTDKNRDSSSSNDSGVSTGSLKHHKCDFNEFEMPVTSAKSCKKHLKCSKQ-MRLSLTPA-AEFLKASSSDPMKNLTFHFEEVATMTKSNSCDVDTLTRRKKR 768          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|930666696|gb|KPJ07804.1| (hypothetical protein RR48_12646 [Papilio machaon])

HSP 1 Score: 154.451 bits (389), Expect = 1.605e-41
Identity = 91/115 (79.13%), Postives = 99/115 (86.09%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRKT 115
            AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHH+GDF +FE  V NSKS KKH K NKQ  R +LTPVH+ F+KSNSSDPLK+LTF FEEV+ L KSNS DVDTLT RK+KT
Sbjct:  511 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHRGDFNDFESAVHNSKSYKKHFKSNKQ-FRNTLTPVHTPFIKSNSSDPLKHLTFQFEEVATLAKSNSFDVDTLTRRKKKT 624          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|930657457|gb|KPI99761.1| (Protein Dok-7 [Papilio xuthus])

HSP 1 Score: 154.451 bits (389), Expect = 2.089e-41
Identity = 91/115 (79.13%), Postives = 99/115 (86.09%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRKT 115
            AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHH+GDF +FE  V NSKS KKH K NKQ  R +LTPVH+ F+KSNSSDPLK+LTF FEEV+ L KSNS DVDTLT RK+KT
Sbjct:  627 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHRGDFNDFENTVPNSKSYKKHFKSNKQ-FRNTLTPVHTPFIKSNSSDPLKHLTFQFEEVATLAKSNSFDVDTLTRRKKKT 740          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|943972990|ref|XP_014367921.1| (PREDICTED: uncharacterized protein LOC106718364 [Papilio machaon])

HSP 1 Score: 154.451 bits (389), Expect = 2.518e-41
Identity = 91/115 (79.13%), Postives = 99/115 (86.09%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRKT 115
            AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHH+GDF +FE  V NSKS KKH K NKQ  R +LTPVH+ F+KSNSSDPLK+LTF FEEV+ L KSNS DVDTLT RK+KT
Sbjct:  606 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHRGDFNDFESAVHNSKSYKKHFKSNKQ-FRNTLTPVHTPFIKSNSSDPLKHLTFQFEEVATLAKSNSFDVDTLTRRKKKT 719          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|910352277|ref|XP_013180091.1| (PREDICTED: protein Dok-7-like [Papilio xuthus])

HSP 1 Score: 154.451 bits (389), Expect = 2.898e-41
Identity = 91/115 (79.13%), Postives = 99/115 (86.09%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRKT 115
            AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHH+GDF +FE  V NSKS KKH K NKQ  R +LTPVH+ F+KSNSSDPLK+LTF FEEV+ L KSNS DVDTLT RK+KT
Sbjct:  659 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHRGDFNDFENIVPNSKSYKKHFKSNKQ-FRNTLTPVHTPFIKSNSSDPLKHLTFQFEEVATLAKSNSFDVDTLTRRKKKT 772          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|914560454|gb|KOB67651.1| (Protein Dok-7, partial [Operophtera brumata])

HSP 1 Score: 147.902 bits (372), Expect = 1.214e-39
Identity = 88/113 (77.88%), Postives = 98/113 (86.73%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKR 113
             VKIRRS+SVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDF +FEMP+TN+KSMKKH+K   + MR S+TPVH    KSNSSDPLKNLTF FEEV+ LTKSNSCD +TLT RK+
Sbjct:  445 VVKIRRSASVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDF-DFEMPITNAKSMKKHLK--SKQMRSSMTPVH--VPKSNSSDPLKNLTFQFEEVATLTKSNSCDAETLTRRKK 552          
BLAST of OSCA025969-RA vs. genbank:protein
Match: gi|827542506|ref|XP_012544323.1| (PREDICTED: protein Dok-7-like [Bombyx mori])

HSP 1 Score: 143.28 bits (360), Expect = 2.231e-37
Identity = 86/114 (75.44%), Postives = 96/114 (84.21%), Query Frame = 0
Query:    1 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNSKSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKSNSCDVDTLTMRKRK 114
            AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDF EFE PVTNSKS+KKH+K +KQ  R+   P     VKSNSSDPLKNLTF F+EV+ LT++ SCD DTLT RK++
Sbjct:  645 AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDF-EFETPVTNSKSVKKHLK-SKQT-RRGPAPAQETIVKSNSSDPLKNLTFQFDEVATLTRAGSCDADTLTRRKKR 755          
The following BLAST results are available for this feature:
BLAST of OSCA025969-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913328148|ref|XP_013195567.1|5.466e-4785.84PREDICTED: uncharacterized protein LOC106138830 [A... [more]
gi|509172675|gb|JAA84458.1|1.545e-4576.32Uncharacterized protein, partial [Pararge aegeria][more]
gi|1073542223|gb|JAT88223.1|7.890e-4581.58hypothetical protein g.11883, partial [Pectinophor... [more]
gi|768422693|ref|XP_011552217.1|2.418e-4278.07PREDICTED: uncharacterized protein LOC105383801 [P... [more]
gi|930666696|gb|KPJ07804.1|1.605e-4179.13hypothetical protein RR48_12646 [Papilio machaon][more]
gi|930657457|gb|KPI99761.1|2.089e-4179.13Protein Dok-7 [Papilio xuthus][more]
gi|943972990|ref|XP_014367921.1|2.518e-4179.13PREDICTED: uncharacterized protein LOC106718364 [P... [more]
gi|910352277|ref|XP_013180091.1|2.898e-4179.13PREDICTED: protein Dok-7-like [Papilio xuthus][more]
gi|914560454|gb|KOB67651.1|1.214e-3977.88Protein Dok-7, partial [Operophtera brumata][more]
gi|827542506|ref|XP_012544323.1|2.231e-3775.44PREDICTED: protein Dok-7-like [Bombyx mori][more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_15571contignewscf_15571:202..546 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025969-RAOSCA025969-RAOstrinia scapulalismRNAnewscf_15571 202..546 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025969-PA ID=OSCA025969-PA|Name=OSCA025969-RA|organism=Ostrinia scapulalis|type=polypeptide|length=115bp
AVKIRRSSSVPSKSDKNRDSSSSNDSGVSTGSLKHHKGDFKEFEMPVTNS
KSMKKHIKCNKQNMRKSLTPVHSAFVKSNSSDPLKNLTFHFEEVSALTKS
NSCDVDTLTMRKRKT
back to top