OSCA025970-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025970-RA
Unique NameOSCA025970-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length67
Homology
BLAST of OSCA025970-RA vs. genbank:protein
Match: gi|357607018|gb|EHJ65322.1| (hypothetical protein KGM_12889 [Danaus plexippus])

HSP 1 Score: 63.929 bits (154), Expect = 3.458e-11
Identity = 30/51 (58.82%), Postives = 34/51 (66.67%), Query Frame = 0
Query:   17 ESAEDLPDTEPEVPGHTLIQPEEGMLQSSQKYPQDSVGRNVYGNLGQLSIT 67
            ES EDLP  E   PGHTL++P  GML+SS K+P   VG  VYGNL  L IT
Sbjct:   55 ESVEDLPKAEKIHPGHTLLRPAFGMLKSSVKFPHKDVGGAVYGNLANLGIT 105          
The following BLAST results are available for this feature:
BLAST of OSCA025970-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|357607018|gb|EHJ65322.1|3.458e-1158.82hypothetical protein KGM_12889 [Danaus plexippus][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_33484contignewscf_33484:985..1188 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025970-RAOSCA025970-RAOstrinia scapulalismRNAnewscf_33484 985..1188 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025970-PA ID=OSCA025970-PA|Name=OSCA025970-RA|organism=Ostrinia scapulalis|type=polypeptide|length=67bp
RRDISEEPVLSDNSEQESAEDLPDTEPEVPGHTLIQPEEGMLQSSQKYPQ
DSVGRNVYGNLGQLSIT
back to top