OSCA025971-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025971-RA
Unique NameOSCA025971-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length66
Homology
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 85.8853 bits (211), Expect = 3.980e-18
Identity = 38/48 (79.17%), Postives = 42/48 (87.50%), Query Frame = 0
Query:   19 RIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            RI KLKWQWAGH+ RR+D RWG K+LEWRPRTGK SVG PPTRWTDD+
Sbjct:  913 RISKLKWQWAGHIARRSDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 960          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 82.0333 bits (201), Expect = 5.910e-18
Identity = 38/49 (77.55%), Postives = 41/49 (83.67%), Query Frame = 0
Query:   18 QRIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            +RI  LKWQWAGH+ RRTD RWG KVLEWRPR GK SVG PPTRWTDD+
Sbjct:  112 KRISSLKWQWAGHIARRTDGRWGRKVLEWRPRIGKRSVGRPPTRWTDDL 160          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|827536156|ref|XP_012544942.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101741607, partial [Bombyx mori])

HSP 1 Score: 82.8037 bits (203), Expect = 1.162e-17
Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
Query:   18 QRIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            +RI +LKWQWAGH+ RR D RWG K+LEWRPRTGK SVG PPTRWTDD+
Sbjct:  189 RRISELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 237          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 80.1073 bits (196), Expect = 1.411e-17
Identity = 37/48 (77.08%), Postives = 40/48 (83.33%), Query Frame = 0
Query:   19 RIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            R+ KLKWQWAGH+ RRTD RW  +VLEWRPRTGK SVG PP RWTDDI
Sbjct:   80 RVSKLKWQWAGHIARRTDGRWSRRVLEWRPRTGKRSVGRPPARWTDDI 127          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 83.9593 bits (206), Expect = 2.084e-17
Identity = 37/48 (77.08%), Postives = 41/48 (85.42%), Query Frame = 0
Query:   19 RIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            RI +LKWQWAGH+ RR D RWG K+LEWRPRTGK SVG PPTRWTDD+
Sbjct:  913 RISELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 960          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|298204323|gb|ADI61810.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 83.1889 bits (204), Expect = 3.888e-17
Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = 0
Query:    8 RPATVFVLRWQRIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            R  T  +   +R+ KLKWQWAGH+ RRTD+RWG +VLEWRPRTGK SVG PP RW+DD+
Sbjct:  894 RAKTKVIDIARRVSKLKWQWAGHICRRTDNRWGRRVLEWRPRTGKRSVGRPPARWSDDL 952          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|825740729|ref|WP_047149332.1| (hypothetical protein [Escherichia coli])

HSP 1 Score: 82.8037 bits (203), Expect = 5.057e-17
Identity = 37/48 (77.08%), Postives = 42/48 (87.50%), Query Frame = 0
Query:   19 RIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            +I KLKWQWAGH+ RRTD+RWG +VLEWRPRTGK SVG PP RWTDD+
Sbjct:  537 KICKLKWQWAGHICRRTDNRWGRRVLEWRPRTGKRSVGRPPARWTDDL 584          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 82.4185 bits (202), Expect = 6.580e-17
Identity = 37/49 (75.51%), Postives = 40/49 (81.63%), Query Frame = 0
Query:   18 QRIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            QRI  LKWQWAGH+ R TD RWG KVLEWRPRTG+ SVG PPTRW DD+
Sbjct:  908 QRIATLKWQWAGHIARGTDGRWGQKVLEWRPRTGRRSVGRPPTRWADDL 956          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|827540150|ref|XP_012553149.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101739909, partial [Bombyx mori])

HSP 1 Score: 81.6481 bits (200), Expect = 7.963e-17
Identity = 37/49 (75.51%), Postives = 42/49 (85.71%), Query Frame = 0
Query:   18 QRIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            +RI  LKWQWAGH+ RR+D RWG K+LEWRPRTGK SVG PPTRWTDD+
Sbjct:  299 RRISTLKWQWAGHIARRSDCRWGGKILEWRPRTGKRSVGRPPTRWTDDL 347          
BLAST of OSCA025971-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 81.2629 bits (199), Expect = 1.050e-16
Identity = 36/48 (75.00%), Postives = 40/48 (83.33%), Query Frame = 0
Query:   19 RIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRTGKCSVGFPPTRWTDDI 66
            RI K+KWQWAGH+ RR D RWG KVLEWRPR G+ SVG PPTRWTDD+
Sbjct:  283 RIAKIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDL 330          
The following BLAST results are available for this feature:
BLAST of OSCA025971-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|298204327|gb|ADI61812.1|3.980e-1879.17endonuclease-reverse transcriptase [Bombyx mori][more]
gi|357603461|gb|EHJ63790.1|5.910e-1877.55endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|827536156|ref|XP_012544942.1|1.162e-1775.51PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|825740785|ref|WP_047149388.1|1.411e-1777.08hypothetical protein, partial [Escherichia coli][more]
gi|298204325|gb|ADI61811.1|2.084e-1777.08endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204323|gb|ADI61810.1|3.888e-1764.41endonuclease-reverse transcriptase [Bombyx mori][more]
gi|825740729|ref|WP_047149332.1|5.057e-1777.08hypothetical protein [Escherichia coli][more]
gi|298204337|gb|ADI61817.1|6.580e-1775.51endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827540150|ref|XP_012553149.1|7.963e-1775.51PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|134001247|gb|ABO45233.1|1.050e-1675.00reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_33780contignewscf_33780:951..1148 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025971-RAOSCA025971-RAOstrinia scapulalismRNAnewscf_33780 951..1148 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025971-PA ID=OSCA025971-PA|Name=OSCA025971-RA|organism=Ostrinia scapulalis|type=polypeptide|length=66bp
MHIGDCRRPATVFVLRWQRIGKLKWQWAGHMVRRTDDRWGSKVLEWRPRT
GKCSVGFPPTRWTDDI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity