OSCA025972-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025972-RA
Unique NameOSCA025972-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length176
Homology
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|914572857|gb|KOB75589.1| (Alcohol dehydrogenase [Operophtera brumata])

HSP 1 Score: 212.616 bits (540), Expect = 1.563e-66
Identity = 98/173 (56.65%), Postives = 128/173 (73.99%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNYE 173
            ME+ +KN VA++TGG+ GIG  I  +FL   AK V+++D  + +G   +  LN +YGDGKA+F K DVT+DLD++ KK+ E Y  +D+LVNNAG VDE S R+T+++N+IA +EWSMKF   MRKDKGG GGTILNI SIY + +DP V FYK SKFAV GFT +LGH  NY+
Sbjct:    1 MERSLKNTVAVITGGAEGIGYEITAKFLEQQAKTVIVLDNNEEKGAAAVVDLNSKYGDGKAVFIKCDVTKDLDDVSKKIFETYSQVDVLVNNAGTVDEKSARKTIELNSIALMEWSMKFWEHMRKDKGGLGGTILNIGSIYSFAIDPYVVFYKASKFAVQGFTTSLGHADNYK 173          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|943958907|ref|XP_014362123.1| (PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)]-like [Papilio machaon] >gi|930671687|gb|KPJ12399.1| 15-hydroxyprostaglandin dehydrogenase [NAD+] [Papilio machaon])

HSP 1 Score: 206.453 bits (524), Expect = 3.573e-64
Identity = 92/172 (53.49%), Postives = 133/172 (77.33%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNY 172
            M + +K+K  ++TGG+ GIG AI E FL +  K V+I+D  +  G E  +KL+ +YG  KA+F K DVT DL+ I+ +++E+Y+ +D+LVNNAG+++++++++T+DVN IA +EWS+KF   MRKDK GNGGTI+N+ASIYGY +DP VP Y  SKFAVMGFT++LGHVKN+
Sbjct:    1 MTEVLKDKTIVITGGAVGIGYAIAESFLQNNPKVVIILDVNEEFGTEASKKLSSKYGKKKAVFLKCDVTTDLEVIFNRIIEEYRNVDVLVNNAGMLNDSAVKKTIDVNMIALMEWSLKFWEHMRKDKSGNGGTIINMASIYGYRIDPYVPIYHASKFAVMGFTKSLGHVKNF 172          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|914614954|ref|NP_001298890.1| (alcohol dehydrogenase 1-like [Papilio xuthus] >gi|389609883|dbj|BAM18553.1| photoreceptor dehydrogenase [Papilio xuthus] >gi|930661798|gb|KPJ03685.1| Alcohol dehydrogenase 1 [Papilio xuthus])

HSP 1 Score: 203.756 bits (517), Expect = 4.321e-63
Identity = 91/172 (52.91%), Postives = 129/172 (75.00%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNY 172
            M +E++NK  ++TGG+ GIG  I E FL    + V+I+D  +  G E ++KL ++YG  KA+F+K DVT DL+ I++K+++++  +D+LVNNAGI ++  +R+T+DVN IA +EWS+KF   MR DK G GGTI+NIASIYGY VDP VP Y  SKFAVMGFT++LGH+KN+
Sbjct:    1 MARELQNKTIVITGGAMGIGYEIAENFLQKDPRVVIILDINEKFGAEAIKKLEVKYGKNKAVFYKCDVTTDLEVIFEKIIKEFTAVDVLVNNAGICNDNYLRKTIDVNVIALMEWSLKFWKHMRTDKSGKGGTIINIASIYGYRVDPYVPVYHASKFAVMGFTKSLGHIKNF 172          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|909581593|ref|XP_013146791.1| (PREDICTED: alcohol dehydrogenase 2-like [Papilio polytes])

HSP 1 Score: 203.371 bits (516), Expect = 5.800e-63
Identity = 91/172 (52.91%), Postives = 129/172 (75.00%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNY 172
            M +E++NK  ++TGG+ GIG AI + FL    K V+I+D  +  G E +E+L  +YG+ K  F+K DVT DL+ I+ ++++ + T+D+LVNNAGI ++  +R+T+++N IA +EWS+KF   MRKDK GNGGTI+NIASIYG+ VDP VP Y  SKFAVMGFT++LGHVKN+
Sbjct:    1 MARELQNKTIVITGGAVGIGYAIADSFLEKNPKIVIILDINEKLGAEAIERLAAKYGENKVAFYKCDVTTDLEAIFNEIIKTFSTVDVLVNNAGICNDIYVRKTIEINVIAFMEWSLKFWEHMRKDKSGNGGTIINIASIYGFRVDPYVPVYHASKFAVMGFTKSLGHVKNF 172          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|943958899|ref|XP_014362119.1| (PREDICTED: alcohol dehydrogenase 1-like [Papilio machaon] >gi|930671684|gb|KPJ12396.1| Alcohol dehydrogenase 1 [Papilio machaon])

HSP 1 Score: 203.371 bits (516), Expect = 5.939e-63
Identity = 91/172 (52.91%), Postives = 129/172 (75.00%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNY 172
            M +++KNK  +VTGGS GIG AI + FL    K V+I++  + QG E ++KL  +YG  KA+++K DVT DL+ I+ K+++++ T+D+LVNNAGI+++  +R+T+D N IA +EWS+KFL  MRKDK G GGTI+NI+SIYGY  DP +P Y  SKFAVMGFT++LGH  N+
Sbjct:    1 MSRDLKNKTIVVTGGSVGIGYAIADSFLQKNPKVVIILNTNKEQGSEAIKKLAAKYGQNKAVYYKCDVTTDLELIFDKIIKEFNTVDVLVNNAGILNDVYLRKTIDTNVIALMEWSLKFLEHMRKDKSGKGGTIINISSIYGYRTDPYIPVYHASKFAVMGFTKSLGHEHNF 172          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|874594779|gb|AKQ06148.1| (alcohol dehydrogenase AD2 [Cydia pomonella])

HSP 1 Score: 201.445 bits (511), Expect = 3.821e-62
Identity = 90/173 (52.02%), Postives = 131/173 (75.72%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNYE 173
            M K++KNK  ++TGG+ GIG  I + FL  GAK +VI+D  + QG E ++ LN ++G+ KA+F K DVT DL+ + KK+++ Y+ +D+LVNNAGI+++ + R+T+D+N  A +EWS KF N MRKD+GGNGGTI+N+ASIYG+ VDP +P Y+ SKFAV GFT++LG   N++
Sbjct:    1 MAKDLKNKTVVITGGAVGIGFEIADRFLQKGAKVIVILDINEKQGAEAVKTLNSKHGNNKAVFIKCDVTSDLEAVSKKIIDLYKHVDVLVNNAGILNDLAPRKTIDINVTALIEWSFKFWNHMRKDQGGNGGTIINLASIYGFRVDPYLPAYQASKFAVQGFTKSLGDSYNFK 173          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|930661799|gb|KPJ03686.1| (15-hydroxyprostaglandin dehydrogenase [NAD+] [Papilio xuthus])

HSP 1 Score: 201.06 bits (510), Expect = 5.379e-62
Identity = 87/172 (50.58%), Postives = 129/172 (75.00%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNY 172
            M K+++NK  ++TGG+ GIG AI E FL    K V+I+D  +  G + ++KL+ QYG+ KA+F K +V  D++ I+ +++E Y T+D+LVNNAG++++++ ++T+D+N  A +EWS+KF   MRKDK G GGTI+N+ASIYGY +DP VP Y  SKFAVMGFT++LGHV N+
Sbjct:    1 MTKDLQNKTIVITGGAVGIGYAIAESFLQKNPKVVIILDVNEDFGADAIKKLSAQYGEKKAVFLKCNVITDIEVIFNRIIEDYSTVDVLVNNAGMLNDSAFKKTIDINVTALIEWSLKFWEHMRKDKSGKGGTIINMASIYGYVIDPYVPVYHASKFAVMGFTKSLGHVNNF 172          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|910336874|ref|XP_013171986.1| (PREDICTED: 15-hydroxyprostaglandin dehydrogenase [NAD(+)]-like [Papilio xuthus])

HSP 1 Score: 200.675 bits (509), Expect = 6.334e-62
Identity = 87/172 (50.58%), Postives = 129/172 (75.00%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNY 172
            M K+++NK  ++TGG+ GIG AI E FL    K V+I+D  +  G + ++KL+ QYG+ KA+F K +V  D++ I+ +++E Y T+D+LVNNAG++++++ ++T+D+N  A +EWS+KF   MRKDK G GGTI+N+ASIYGY +DP VP Y  SKFAVMGFT++LGHV N+
Sbjct:    1 MTKDLQNKTIVITGGAVGIGYAIAESFLQKNPKVVIILDVNEDFGADAIKKLSAQYGEEKAVFLKCNVITDIEVIFNRIIEDYSTVDVLVNNAGMLNDSAFKKTIDINVTALIEWSLKFWEHMRKDKSGKGGTIINMASIYGYVIDPYVPVYHASKFAVMGFTKSLGHVNNF 172          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|943958872|ref|XP_014362108.1| (PREDICTED: alcohol dehydrogenase 1-like [Papilio machaon] >gi|930671688|gb|KPJ12400.1| Alcohol dehydrogenase 1 [Papilio machaon])

HSP 1 Score: 200.675 bits (509), Expect = 7.283e-62
Identity = 92/172 (53.49%), Postives = 126/172 (73.26%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNY 172
            M +E+KNK  +VTGGS GIG AI + FL   AK V+I++  + QG E   KL  +YG  KA+++K DVT DL+ I+ K++E++ T+D+LVNNAGI+++  +R+T+D N IA +EWS+KF   MRKDK G GGTI+N+ SIYGY  +P VP Y  SKFAVMGFT++LGH  N+
Sbjct:    1 MTRELKNKTIVVTGGSVGIGYAIADSFLQKNAKVVIILNTNEEQGTEAAIKLAAKYGQNKAVYYKCDVTTDLEVIFDKIIEEFTTVDVLVNNAGILNDVYLRKTIDTNVIALMEWSLKFWVHMRKDKSGKGGTIINVNSIYGYRTEPYVPIYHASKFAVMGFTKSLGHEHNF 172          
BLAST of OSCA025972-RA vs. genbank:protein
Match: gi|914555714|gb|KOB65394.1| (Alcohol dehydrogenase [Operophtera brumata])

HSP 1 Score: 199.519 bits (506), Expect = 2.715e-61
Identity = 87/173 (50.29%), Postives = 131/173 (75.72%), Query Frame = 0
Query:    1 MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELMEKLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETSIRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVPFYKTSKFAVMGFTRTLGHVKNYE 173
            M K++KNK  ++TGG+ GIG  I E +L    K V+++D  + QG++ ++KL  +YG+ KA+F K DVT+DL+ + KK+++ ++ +D+L+NNAGI++E +I++T+D+N  A +EWS KF   MRKDK GNGGTI+N+ASIYGY +D  +P Y+ SKFAVMGFT++LGH  NY+
Sbjct:    1 MAKDLKNKTVVITGGAEGIGFEIAENYLKKQVKTVILLDINEKQGVDSVKKLTTKYGEKKAVFIKCDVTKDLEAVSKKILDSFKHVDVLINNAGILNEQAIKKTIDINVTAVIEWSHKFWEHMRKDKEGNGGTIINLASIYGYRIDQFLPAYQASKFAVMGFTKSLGHEYNYK 173          
The following BLAST results are available for this feature:
BLAST of OSCA025972-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914572857|gb|KOB75589.1|1.563e-6656.65Alcohol dehydrogenase [Operophtera brumata][more]
gi|943958907|ref|XP_014362123.1|3.573e-6453.49PREDICTED: 15-hydroxyprostaglandin dehydrogenase [... [more]
gi|914614954|ref|NP_001298890.1|4.321e-6352.91alcohol dehydrogenase 1-like [Papilio xuthus] >gi|... [more]
gi|909581593|ref|XP_013146791.1|5.800e-6352.91PREDICTED: alcohol dehydrogenase 2-like [Papilio p... [more]
gi|943958899|ref|XP_014362119.1|5.939e-6352.91PREDICTED: alcohol dehydrogenase 1-like [Papilio m... [more]
gi|874594779|gb|AKQ06148.1|3.821e-6252.02alcohol dehydrogenase AD2 [Cydia pomonella][more]
gi|930661799|gb|KPJ03686.1|5.379e-6250.5815-hydroxyprostaglandin dehydrogenase [NAD+] [Papi... [more]
gi|910336874|ref|XP_013171986.1|6.334e-6250.58PREDICTED: 15-hydroxyprostaglandin dehydrogenase [... [more]
gi|943958872|ref|XP_014362108.1|7.283e-6253.49PREDICTED: alcohol dehydrogenase 1-like [Papilio m... [more]
gi|914555714|gb|KOB65394.1|2.715e-6150.29Alcohol dehydrogenase [Operophtera brumata][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
molecular_function GO:0016491 oxidoreductase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002198Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 84..95
score: 59.74
coord: 152..171
score: 32.56
coord: 132..140
score: 51.8
IPR002198Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 8..167
e-value: 1.6E-21
score: 76.8
IPR002347Glucose/ribitol dehydrogenasePRINTSPR00081GDHRDHcoord: 84..95
score: 58.38
coord: 152..171
score: 29.95
coord: 9..26
score: 52.37
coord: 126..142
score: 30.67
IPR016040NAD(P)-binding domainGENE3D3.40.50.720coord: 5..167
e-value: 1.5E-46
score: 158.3
NoneNo IPR availablePANTHERPTHR24310FAMILY NOT NAMEDcoord: 5..166
NoneNo IPR availableSUPERFAMILY51735NAD(P)-binding Rossmann-fold domainscoord: 4..168

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_35526contignewscf_35526:736..1263 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025972-RAOSCA025972-RAOstrinia scapulalismRNAnewscf_35526 736..1263 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025972-PA ID=OSCA025972-PA|Name=OSCA025972-RA|organism=Ostrinia scapulalis|type=polypeptide|length=176bp
MEKEIKNKVAIVTGGSRGIGSAIVEEFLCHGAKAVVIVDREQSQGIELME
KLNIQYGDGKAIFFKADVTRDLDEIYKKVVEKYQTIDILVNNAGIVDETS
IRRTLDVNTIATVEWSMKFLNLMRKDKGGNGGTILNIASIYGYTVDPVVP
FYKTSKFAVMGFTRTLGHVKNYEITK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR016040NAD(P)-bd_dom
IPR002347Glc/ribitol_DH
IPR002198DH_sc/Rdtase_SDR