OSCA025999-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA025999-RA
Unique NameOSCA025999-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length65
Homology
BLAST of OSCA025999-RA vs. genbank:protein
Match: gi|641654081|ref|XP_008179060.1| (PREDICTED: RNA-directed DNA polymerase from mobile element jockey-like [Acyrthosiphon pisum])

HSP 1 Score: 66.2402 bits (160), Expect = 2.953e-11
Identity = 28/65 (43.08%), Postives = 40/65 (61.54%), Query Frame = 0
Query:    1 GRSKDNLVRRGFLDGLNMECRCGFVPQSMKHLVSCPECPSNCTQEDLKSATDSATLVAEFWADTV 65
            GR+KDNL++ G LD  +  C CG V Q+M+H+++C  C   CTQED+   T     VA  WA+ +
Sbjct:  887 GRTKDNLIKWGLLDRTDTLCICGEV-QTMQHIITCTACSQTCTQEDIHKGTSQGINVARIWAEII 950          
The following BLAST results are available for this feature:
BLAST of OSCA025999-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|641654081|ref|XP_008179060.1|2.953e-1143.08PREDICTED: RNA-directed DNA polymerase from mobile... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_32702contignewscf_32702:2..199 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025999-RAOSCA025999-RAOstrinia scapulalismRNAnewscf_32702 2..199 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA025999-PA ID=OSCA025999-PA|Name=OSCA025999-RA|organism=Ostrinia scapulalis|type=polypeptide|length=65bp
GRSKDNLVRRGFLDGLNMECRCGFVPQSMKHLVSCPECPSNCTQEDLKSA
TDSATLVAEFWADTV
back to top