OSCA026000-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026000-RA
Unique NameOSCA026000-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length166
Homology
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|913298579|ref|XP_013192900.1| (PREDICTED: blood vessel epicardial substance-like [Amyelois transitella])

HSP 1 Score: 265.003 bits (676), Expect = 8.213e-86
Identity = 121/161 (75.16%), Postives = 141/161 (87.58%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVS--EVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            M+TGLQN+TT+L+ +  +VTE  +   T+EMGL ETT+L+ S   DFVN+TVQERP+MWD+YLNHCPKWRPINHVFFQVANIFFLL+FLAPHT SGLIW+RV LVLGCAFLG+W WS+ECYLDAVLWN  F+VINFVYF+VQFYL+RPIKFHKDIEEV  A
Sbjct:   11 MITGLQNMTTDLSTTANDVTEAAS---TTEMGLQETTKLTSSQASDFVNMTVQERPTMWDLYLNHCPKWRPINHVFFQVANIFFLLSFLAPHTSSGLIWLRVALVLGCAFLGLWAWSIECYLDAVLWNSVFVVINFVYFAVQFYLMRPIKFHKDIEEVYVA 168          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|443429440|gb|AGC92724.1| (blood vessel epicardial substance-like protein [Heliconius erato])

HSP 1 Score: 259.61 bits (662), Expect = 9.282e-84
Identity = 119/160 (74.38%), Postives = 139/160 (86.88%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEVTEVGAEGVTSE-MGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            M+TGLQNVTTE+     TE  A+  T++ MGLLETTR   SAG DFVN+T+QERPSMWDMYLNHCPKWRPINH+FFQ AN+FFLL+FLAPHTPSGL+W+RV L++GCAF G+W WS+ECYLDAV+WN AF+VINFVYF+VQFYLLRPIKFH+DIEEV  A
Sbjct:   11 MITGLQNVTTEVPT---TESDADLTTTDSMGLLETTR--PSAGSDFVNITIQERPSMWDMYLNHCPKWRPINHIFFQAANVFFLLSFLAPHTPSGLLWLRVALIIGCAFSGLWAWSIECYLDAVVWNSAFVVINFVYFAVQFYLLRPIKFHRDIEEVYLA 165          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|909567805|ref|XP_013139328.1| (PREDICTED: blood vessel epicardial substance-like [Papilio polytes])

HSP 1 Score: 244.588 bits (623), Expect = 3.326e-78
Identity = 113/159 (71.07%), Postives = 133/159 (83.65%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            M+TGLQNVTTE++    T+      T +MGLLE TRL+  AG D VNVT+Q+RPSMWD+YL+HCPKWRP+NH+FFQVAN  FL +FLAPHTP+GL+W+RV LVLGC F G+W WSV+CYLDAVLWN AFIVINFVYF+VQFYL+RPIKFHKDIEEV  A
Sbjct:   11 MITGLQNVTTEVST---TDSDVAITTEDMGLLEPTRLAPPAG-DSVNVTLQDRPSMWDVYLHHCPKWRPVNHIFFQVANACFLASFLAPHTPAGLVWLRVALVLGCTFSGLWAWSVQCYLDAVLWNSAFIVINFVYFAVQFYLMRPIKFHKDIEEVYVA 165          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|357621046|gb|EHJ73019.1| (hypothetical protein KGM_02476 [Danaus plexippus])

HSP 1 Score: 243.432 bits (620), Expect = 3.710e-78
Identity = 118/161 (73.29%), Postives = 133/161 (82.61%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEV--TEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            M+TGLQNV      SEV  TE   E  T++MGLLE T  + +   DFVNVT+QERPSMWD+YLNHCPKWRPINH+FFQ AN+FFLL+FLAPHTPSGLIW+RV L+LGC+F G+W WSVECYLDAV+WN  FIVINFVYFSVQFYLLRPIKFHKDIEEV  A
Sbjct:   11 MITGLQNV------SEVPTTESDVES-TTDMGLLEATSRAPTPN-DFVNVTIQERPSMWDVYLNHCPKWRPINHIFFQTANVFFLLSFLAPHTPSGLIWLRVALILGCSFSGLWAWSVECYLDAVVWNCVFIVINFVYFSVQFYLLRPIKFHKDIEEVYLA 163          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|930675975|gb|KPJ16205.1| (Blood vessel epicardial substance-B [Papilio machaon])

HSP 1 Score: 236.498 bits (602), Expect = 9.041e-77
Identity = 110/163 (67.48%), Postives = 135/163 (82.82%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAAHTFS 163
            M+TGLQNVTTE++ ++         T +MGL+E TRL+   G D VNVT+QERPSMWDMYL+HCPKWRP+NH+FFQVAN  FL +FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEE + + T +
Sbjct:   11 MITGLQNVTTEMSTTDSDVTVT---TEDMGLVEPTRLAPPVG-DSVNVTLQERPSMWDMYLHHCPKWRPVNHIFFQVANACFLASFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEERTGSVTLA 169          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|943947648|ref|XP_014356931.1| (PREDICTED: blood vessel epicardial substance-like [Papilio machaon])

HSP 1 Score: 238.039 bits (606), Expect = 2.697e-75
Identity = 111/159 (69.81%), Postives = 133/159 (83.65%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            M+TGLQNVTTE++ ++         T +MGL+E TRL+   G D VNVT+QERPSMWDMYL+HCPKWRP+NH+FFQVAN  FL +FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEEV  A
Sbjct:   11 MITGLQNVTTEMSTTDSDVTVT---TEDMGLVEPTRLAPPVG-DSVNVTLQERPSMWDMYLHHCPKWRPVNHIFFQVANACFLASFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEEVYVA 165          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|914561651|gb|KOB68292.1| (Blood vessel epicardial substance-like protein, partial [Operophtera brumata])

HSP 1 Score: 223.787 bits (569), Expect = 2.335e-72
Identity = 106/156 (67.95%), Postives = 132/156 (84.62%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFH-KDIEE 155
            M++GLQNVT+E++ ++VTE   E   + MGL+ETT+LS     DFVNVT+QERPSMWD+YL+HCPKWRPINHVFFQVAN+FFL +FLAPHT SGLIW+R  L++GCAF G+W  +VEC+LDAV+WN AF+ INFVYF+VQ YL+RPIKFH K+IEE
Sbjct:   11 MISGLQNVTSEVSSTDVTEGTTE-EATTMGLVETTKLSGQTA-DFVNVTLQERPSMWDLYLDHCPKWRPINHVFFQVANMFFLFSFLAPHTSSGLIWLRAALMVGCAFFGLWAMTVECFLDAVVWNSAFVAINFVYFAVQLYLMRPIKFHNKEIEE 164          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|910325815|ref|XP_013166038.1| (PREDICTED: blood vessel epicardial substance-like [Papilio xuthus])

HSP 1 Score: 228.409 bits (581), Expect = 1.517e-71
Identity = 107/159 (67.30%), Postives = 132/159 (83.02%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            M+TGLQNVTTE++ ++         T +MGL+E T L+     D VNVT+QERPSMWD+YL+HCPKWRP+NH+FFQ+AN  FL++FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEEV  A
Sbjct:   11 MITGLQNVTTEVSTTDSDVTVT---TEDMGLVEPTSLTPPVS-DSVNVTLQERPSMWDVYLHHCPKWRPVNHIFFQLANGCFLVSFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEEVYVA 165          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|827556894|ref|XP_012549761.1| (PREDICTED: uncharacterized protein LOC101745580 isoform X1 [Bombyx mori])

HSP 1 Score: 230.335 bits (586), Expect = 9.584e-71
Identity = 107/162 (66.05%), Postives = 131/162 (80.86%), Query Frame = 0
Query:    1 MVTGLQNVTTELA--VSEVT-EVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            MVTGLQN+TTE    +S++T  +  +    EMGL+E T+LS     D VNV++ ++PSMWD+YL+HC KWRPINH+FFQVANIFFL++FLAPHT  G IW+RVGL++GCAF G+W WSVECYLDAVLWN  FI+INFVYFS QFYL+RPIKFHK+IEEV  A
Sbjct:   12 MVTGLQNITTESPSMISDITTSLNTKDKVPEMGLVEPTKLS-LPTSDMVNVSIHDQPSMWDLYLHHCSKWRPINHIFFQVANIFFLMSFLAPHTDIGQIWLRVGLMMGCAFSGMWAWSVECYLDAVLWNSVFILINFVYFSYQFYLMRPIKFHKEIEEVYLA 172          
BLAST of OSCA026000-RA vs. genbank:protein
Match: gi|930663653|gb|KPJ05157.1| (Blood vessel epicardial substance [Papilio xuthus])

HSP 1 Score: 226.483 bits (576), Expect = 1.189e-70
Identity = 106/159 (66.67%), Postives = 131/159 (82.39%), Query Frame = 0
Query:    1 MVTGLQNVTTELAVSEVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTVQERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSAA 159
            M+TGLQNVTTE++ ++         T +MG +E T L+     D VNVT+QERPSMWD+YL+HCPKWRP+NH+FFQ+AN  FL++FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEEV  A
Sbjct:   11 MITGLQNVTTEVSTTDSDVTVT---TEDMGPVEPTSLTPPVS-DSVNVTLQERPSMWDVYLHHCPKWRPVNHIFFQLANGCFLVSFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEEVYVA 165          
The following BLAST results are available for this feature:
BLAST of OSCA026000-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913298579|ref|XP_013192900.1|8.213e-8675.16PREDICTED: blood vessel epicardial substance-like ... [more]
gi|443429440|gb|AGC92724.1|9.282e-8474.38blood vessel epicardial substance-like protein [He... [more]
gi|909567805|ref|XP_013139328.1|3.326e-7871.07PREDICTED: blood vessel epicardial substance-like ... [more]
gi|357621046|gb|EHJ73019.1|3.710e-7873.29hypothetical protein KGM_02476 [Danaus plexippus][more]
gi|930675975|gb|KPJ16205.1|9.041e-7767.48Blood vessel epicardial substance-B [Papilio macha... [more]
gi|943947648|ref|XP_014356931.1|2.697e-7569.81PREDICTED: blood vessel epicardial substance-like ... [more]
gi|914561651|gb|KOB68292.1|2.335e-7267.95Blood vessel epicardial substance-like protein, pa... [more]
gi|910325815|ref|XP_013166038.1|1.517e-7167.30PREDICTED: blood vessel epicardial substance-like ... [more]
gi|827556894|ref|XP_012549761.1|9.584e-7166.05PREDICTED: uncharacterized protein LOC101745580 is... [more]
gi|930663653|gb|KPJ05157.1|1.189e-7066.67Blood vessel epicardial substance [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0016020 membrane
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12101:SF1BVEScoord: 64..156
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 95..116
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 117..121
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 89..94
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 145..166
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..68
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 122..144
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 69..88
NoneNo IPR availableTMHMMTMhelixcoord: 122..144
NoneNo IPR availableTMHMMTMhelixcoord: 96..115
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
IPR006916Popeye proteinPANTHERPTHR12101POPEYE DOMAIN CONTAINING PROTEINcoord: 64..156

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_16608contignewscf_16608:4040..4540 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026000-RAOSCA026000-RAOstrinia scapulalismRNAnewscf_16608 4040..4540 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026000-PA ID=OSCA026000-PA|Name=OSCA026000-RA|organism=Ostrinia scapulalis|type=polypeptide|length=166bp
MVTGLQNVTTELAVSEVTEVGAEGVTSEMGLLETTRLSDSAGGDFVNVTV
QERPSMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRV
GLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFH
KDIEEVSAAHTFSYCI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR006916Popeye_prot