OSCA026001-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026001-RA
Unique NameOSCA026001-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length48
Homology
BLAST of OSCA026001-RA vs. genbank:protein
Match: gi|913316145|ref|XP_013188994.1| (PREDICTED: uncharacterized protein LOC106133722 [Amyelois transitella])

HSP 1 Score: 59.6918 bits (143), Expect = 3.652e-9
Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 0
Query:    1 MFQYEYEKRPPSAGSCDSRATVTTDWSRRYP 31
            MFQYE+EKRPPS+ SC+SRAT+TTDWSR YP
Sbjct:    1 MFQYEFEKRPPSSTSCESRATMTTDWSRVYP 31          
The following BLAST results are available for this feature:
BLAST of OSCA026001-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|913316145|ref|XP_013188994.1|3.652e-980.65PREDICTED: uncharacterized protein LOC106133722 [A... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_43320contignewscf_43320:794..937 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026001-RAOSCA026001-RAOstrinia scapulalismRNAnewscf_43320 794..937 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026001-PA ID=OSCA026001-PA|Name=OSCA026001-RA|organism=Ostrinia scapulalis|type=polypeptide|length=48bp
MFQYEYEKRPPSAGSCDSRATVTTDWSRRYPPPTPARARPLPCERDRA
back to top