OSCA026003-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026003-RA
Unique NameOSCA026003-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length122
Homology
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 93.5893 bits (231), Expect = 7.015e-20
Identity = 48/63 (76.19%), Postives = 53/63 (84.13%), Query Frame = 0
Query:   59 TAIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIARS--QIKWQWAGHIARRDDG 119
            TA  IRRLKVTQRAMERAMLGV LR+R+RN+ IR RTKVTDIAR    +KW+WAGHIARR DG
Sbjct:  646 TAGNIRRLKVTQRAMERAMLGVSLRDRVRNDAIRSRTKVTDIARRIVNLKWRWAGHIARRTDG 708          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 87.4261 bits (215), Expect = 4.053e-19
Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 0
Query:   59 TAIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIAR--SQIKWQWAGHIARRDDG 119
            T  +++RL+V QRAMERAM+GV LR+RIRN+EIR+R K TDIA+  S +KWQWAGHIARR DG
Sbjct:   69 TKGLMKRLRVAQRAMERAMIGVSLRDRIRNDEIRRRMKGTDIAKRISSLKWQWAGHIARRTDG 131          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 90.8929 bits (224), Expect = 6.351e-19
Identity = 48/69 (69.57%), Postives = 58/69 (84.06%), Query Frame = 0
Query:   53 ETFSAPTAIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIAR--SQIKWQWAGHIARRDDG 119
            ET+S  T  ++RRLKVTQRAMERAMLGV LR++IRNEEIR++T VTDIA+  + +KWQWAGHIAR  DG
Sbjct:  860 ETWSL-TMGLMRRLKVTQRAMERAMLGVSLRDQIRNEEIRRKTMVTDIAQRIATLKWQWAGHIARGTDG 927          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|189181684|ref|NP_001121193.1| (phosphatidylinositol 3-kinase 60 [Bombyx mori] >gi|186898235|gb|ACC94001.1| phosphatidylinositol 3-kinase 60 [Bombyx mori])

HSP 1 Score: 90.5077 bits (223), Expect = 7.720e-19
Identity = 45/75 (60.00%), Postives = 57/75 (76.00%), Query Frame = 0
Query:   51 PLETFSAPTAIV----IRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIARS--QIKWQWAGHIARRDDG 119
            P+ T+   T ++    +R+LKVTQRAMERAMLGV L ++IRNEEIR++T VTDIA+    +KWQW GHIARR DG
Sbjct:   73 PMMTYGTETWLLTMGLMRKLKVTQRAMERAMLGVSLGDQIRNEEIRRKTMVTDIAQRIVTLKWQWTGHIARRTDG 147          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|838097688|gb|KLV34200.1| (hypothetical protein AB894_15325, partial [Piscirickettsia salmonis])

HSP 1 Score: 88.1965 bits (217), Expect = 5.188e-18
Identity = 46/69 (66.67%), Postives = 57/69 (82.61%), Query Frame = 0
Query:   53 ETFSAPTAIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIARS--QIKWQWAGHIARRDDG 119
            ET+S  TA ++ RL+V QRAMERAMLGV LR++IRN EIR+RT+VTDIA    ++KWQWAGH+ARR DG
Sbjct:  693 ETWSL-TAGLLERLRVAQRAMERAMLGVSLRDKIRNMEIRQRTRVTDIALKICRLKWQWAGHVARRTDG 760          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|298204341|gb|ADI61819.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 87.4261 bits (215), Expect = 1.039e-17
Identity = 45/75 (60.00%), Postives = 55/75 (73.33%), Query Frame = 0
Query:   51 PLETFSAPT----AIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIAR--SQIKWQWAGHIARRDDG 119
            P+ T+ A T      ++R+ KV QRAMER MLGV L +R+RNEEIR+RTKVTDIA   S++KWQWAGH  RR DG
Sbjct:  853 PVMTYGAETWTLTVGLVRKFKVAQRAMERCMLGVSLMDRLRNEEIRQRTKVTDIALKISKLKWQWAGHTCRRTDG 927          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|298204323|gb|ADI61810.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 87.4261 bits (215), Expect = 1.049e-17
Identity = 46/74 (62.16%), Postives = 56/74 (75.68%), Query Frame = 0
Query:   51 PLETFSAPT----AIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIAR--SQIKWQWAGHIARRDD 118
            P+ T+ A T      ++ +LKVTQRAMERAMLG+ LR+RIRNE IR +TKV DIAR  S++KWQWAGHI RR D
Sbjct:  849 PVLTYGAETWTLTVRLVHKLKVTQRAMERAMLGLSLRDRIRNEVIRAKTKVIDIARRVSKLKWQWAGHICRRTD 922          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|357612130|gb|EHJ67822.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 82.0333 bits (201), Expect = 1.864e-17
Identity = 41/63 (65.08%), Postives = 52/63 (82.54%), Query Frame = 0
Query:   59 TAIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIAR--SQIKWQWAGHIARRDDG 119
            T  ++ RL+V QRAME+AML V LR+R+RN+EIR+RT+VTDIA+  S +KWQ AGHIARR DG
Sbjct:   44 TKGLMNRLRVVQRAMEKAMLAVSLRDRVRNDEIRRRTRVTDIAKRISSLKWQCAGHIARRTDG 106          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|298204339|gb|ADI61818.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 85.5001 bits (210), Expect = 5.306e-17
Identity = 45/74 (60.81%), Postives = 56/74 (75.68%), Query Frame = 0
Query:   51 PLETFSAPT----AIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIAR--SQIKWQWAGHIARRDD 118
            P+ T+ A T      ++R+LKV QRAMERAMLGV L+++IRNE IR RTKV DIA+  S++KWQWAGHI RR D
Sbjct:  854 PVMTYGAETWTLTVRLVRQLKVAQRAMERAMLGVSLKDKIRNEIIRPRTKVIDIAQRVSKLKWQWAGHICRRTD 927          
BLAST of OSCA026003-RA vs. genbank:protein
Match: gi|357622103|gb|EHJ73704.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 85.1149 bits (209), Expect = 5.925e-17
Identity = 45/75 (60.00%), Postives = 56/75 (74.67%), Query Frame = 0
Query:   51 PLETFSAPT----AIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDIAR--SQIKWQWAGHIARRDDG 119
            P+ T+ A T      ++ +LKV QRAMERA+LGV LR+RIRNE IR+RTKV DIA   S++KWQWAGHI+RR D 
Sbjct:  299 PVMTYGAETWTLTVRLVHQLKVAQRAMERAILGVSLRDRIRNEVIRQRTKVIDIAHRISKLKWQWAGHISRRTDN 373          
The following BLAST results are available for this feature:
BLAST of OSCA026003-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|909577882|ref|XP_013144778.1|7.015e-2076.19PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|357603461|gb|EHJ63790.1|4.053e-1968.25endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204337|gb|ADI61817.1|6.351e-1969.57endonuclease-reverse transcriptase [Bombyx mori][more]
gi|189181684|ref|NP_001121193.1|7.720e-1960.00phosphatidylinositol 3-kinase 60 [Bombyx mori] >gi... [more]
gi|838097688|gb|KLV34200.1|5.188e-1866.67hypothetical protein AB894_15325, partial [Pisciri... [more]
gi|298204341|gb|ADI61819.1|1.039e-1760.00endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204323|gb|ADI61810.1|1.049e-1762.16endonuclease-reverse transcriptase [Bombyx mori][more]
gi|357612130|gb|EHJ67822.1|1.864e-1765.08endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204339|gb|ADI61818.1|5.306e-1760.81endonuclease-reverse transcriptase [Bombyx mori][more]
gi|357622103|gb|EHJ73704.1|5.925e-1760.00endonuclease-reverse transcriptase [Danaus plexipp... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0016310 phosphorylation
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19068contignewscf_19068:2992..3360 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026003-RAOSCA026003-RAOstrinia scapulalismRNAnewscf_19068 2992..3360 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026003-PA ID=OSCA026003-PA|Name=OSCA026003-RA|organism=Ostrinia scapulalis|type=polypeptide|length=122bp
PNDVYCWTKAYPKVFHNERSCAACIQALPETFRSSVHLVGGLPTSYSPWS
PLETFSAPTAIVIRRLKVTQRAMERAMLGVPLRNRIRNEEIRKRTKVTDI
ARSQIKWQWAGHIARRDDGLSL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0016310phosphorylation
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity