OSCA026004-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026004-RA
Unique NameOSCA026004-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length48
Homology
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|913326707|ref|XP_013194777.1| (PREDICTED: probable serine/threonine-protein kinase kinX isoform X1 [Amyelois transitella] >gi|913326709|ref|XP_013194778.1| PREDICTED: probable serine/threonine-protein kinase kinX isoform X2 [Amyelois transitella])

HSP 1 Score: 70.8626 bits (172), Expect = 4.075e-13
Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            M    D DS++ +K+GLD+YPTPHQTLPPLF EN+YKW D  F+D TR
Sbjct:  925 MDELGDTDSIHDKKRGLDMYPTPHQTLPPLFTENDYKWADRTFDDDTR 972          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|913326711|ref|XP_013194779.1| (PREDICTED: probable serine/threonine-protein kinase kinX isoform X3 [Amyelois transitella])

HSP 1 Score: 70.8626 bits (172), Expect = 4.238e-13
Identity = 30/48 (62.50%), Postives = 37/48 (77.08%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            M    D DS++ +K+GLD+YPTPHQTLPPLF EN+YKW D  F+D TR
Sbjct:  925 MDELGDTDSIHDKKRGLDMYPTPHQTLPPLFTENDYKWADRTFDDDTR 972          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|909579093|ref|XP_013145430.1| (PREDICTED: uncharacterized protein LOC106108715 [Papilio polytes])

HSP 1 Score: 69.707 bits (169), Expect = 1.020e-12
Identity = 33/48 (68.75%), Postives = 39/48 (81.25%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            MP +S+ DSV  EK+GLDLYPTPHQTLPPL+AE +YKW D  + DSTR
Sbjct:  710 MPRFSESDSV-QEKRGLDLYPTPHQTLPPLYAERDYKWTDNTYLDSTR 756          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|512898243|ref|XP_004924352.1| (PREDICTED: uncharacterized protein LOC101742334 isoform X2 [Bombyx mori])

HSP 1 Score: 66.6254 bits (161), Expect = 1.328e-11
Identity = 30/47 (63.83%), Postives = 38/47 (80.85%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDST 47
            M TYSD DS+ S K+ LDLYPTPHQTLPPL+ EN+YKW D K++++ 
Sbjct:  695 MKTYSDTDSLKSGKRDLDLYPTPHQTLPPLYTENDYKWPDVKYDNTA 741          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|512898239|ref|XP_004924351.1| (PREDICTED: uncharacterized protein LOC101742334 isoform X1 [Bombyx mori])

HSP 1 Score: 66.6254 bits (161), Expect = 1.355e-11
Identity = 30/47 (63.83%), Postives = 38/47 (80.85%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDST 47
            M TYSD DS+ S K+ LDLYPTPHQTLPPL+ EN+YKW D K++++ 
Sbjct:  695 MKTYSDTDSLKSGKRDLDLYPTPHQTLPPLYTENDYKWPDVKYDNTA 741          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|930678028|gb|KPJ18008.1| (hypothetical protein RR48_02779 [Papilio machaon])

HSP 1 Score: 62.003 bits (149), Expect = 1.539e-11
Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            MP +SD DS+  EK+GLDLYPTPHQTLPPL+ E +YKW +  + DSTR
Sbjct:    1 MPRFSDSDSI-QEKRGLDLYPTPHQTLPPLY-EQDYKWANNTYLDSTR 46          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|943941805|ref|XP_014372259.1| (PREDICTED: uncharacterized protein LOC106721733 isoform X1 [Papilio machaon])

HSP 1 Score: 63.1586 bits (152), Expect = 1.995e-10
Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            MP +SD DS+  EK+GLDLYPTPHQTLPPL+ E +YKW +  + DSTR
Sbjct:  353 MPRFSDSDSI-QEKRGLDLYPTPHQTLPPLY-EQDYKWANNTYLDSTR 398          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|943941807|ref|XP_014372260.1| (PREDICTED: uncharacterized protein LOC106721733 isoform X2 [Papilio machaon])

HSP 1 Score: 63.1586 bits (152), Expect = 2.134e-10
Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            MP +SD DS+  EK+GLDLYPTPHQTLPPL+ E +YKW +  + DSTR
Sbjct:  353 MPRFSDSDSI-QEKRGLDLYPTPHQTLPPLY-EQDYKWANNTYLDSTR 398          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|930662109|gb|KPJ03906.1| (hypothetical protein RR46_01858 [Papilio xuthus])

HSP 1 Score: 62.3882 bits (150), Expect = 2.787e-10
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            MP +SD DS+  EK+GLDLYPTPHQTLPPL+ E +YKW    + DSTR
Sbjct:  150 MPRFSDSDSI-QEKRGLDLYPTPHQTLPPLY-EQDYKWAHNTYLDSTR 195          
BLAST of OSCA026004-RA vs. genbank:protein
Match: gi|930664769|gb|KPJ05912.1| (hypothetical protein RR46_00668 [Papilio xuthus])

HSP 1 Score: 62.003 bits (149), Expect = 3.051e-10
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 0
Query:    1 MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR 48
            MP +SD DS+  EK+GLDLYPTPHQTLPPL+ E +YKW    + DSTR
Sbjct:  150 MPRFSDSDSI-QEKRGLDLYPTPHQTLPPLY-EQDYKWAHNTYLDSTR 195          
The following BLAST results are available for this feature:
BLAST of OSCA026004-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|913326707|ref|XP_013194777.1|4.075e-1362.50PREDICTED: probable serine/threonine-protein kinas... [more]
gi|913326711|ref|XP_013194779.1|4.238e-1362.50PREDICTED: probable serine/threonine-protein kinas... [more]
gi|909579093|ref|XP_013145430.1|1.020e-1268.75PREDICTED: uncharacterized protein LOC106108715 [P... [more]
gi|512898243|ref|XP_004924352.1|1.328e-1163.83PREDICTED: uncharacterized protein LOC101742334 is... [more]
gi|512898239|ref|XP_004924351.1|1.355e-1163.83PREDICTED: uncharacterized protein LOC101742334 is... [more]
gi|930678028|gb|KPJ18008.1|1.539e-1164.58hypothetical protein RR48_02779 [Papilio machaon][more]
gi|943941805|ref|XP_014372259.1|1.995e-1064.58PREDICTED: uncharacterized protein LOC106721733 is... [more]
gi|943941807|ref|XP_014372260.1|2.134e-1064.58PREDICTED: uncharacterized protein LOC106721733 is... [more]
gi|930662109|gb|KPJ03906.1|2.787e-1064.58hypothetical protein RR46_01858 [Papilio xuthus][more]
gi|930664769|gb|KPJ05912.1|3.051e-1064.58hypothetical protein RR46_00668 [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_44627contignewscf_44627:16..159 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026004-RAOSCA026004-RAOstrinia scapulalismRNAnewscf_44627 16..159 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026004-PA ID=OSCA026004-PA|Name=OSCA026004-RA|organism=Ostrinia scapulalis|type=polypeptide|length=48bp
MPTYSDRDSVYSEKQGLDLYPTPHQTLPPLFAENEYKWDDGKFEDSTR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane