OSCA026007-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026007-RA
Unique NameOSCA026007-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length266
Homology
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|1073544495|gb|JAT89359.1| (hypothetical protein g.2020 [Pectinophora gossypiella])

HSP 1 Score: 144.436 bits (363), Expect = 1.836e-36
Identity = 108/266 (40.60%), Postives = 144/266 (54.14%), Query Frame = 0
Query:   20 VVNAEGEWDVEDIEMTGNLNTDKNLSDDDDDELAEKDXCMDEDDGDEPRENISDDDXSNEKEESSDDEEMDQDSESENESNDENGKESDSESKIGEDSESDVETPSSTGKLAKAITAD-------------------------TKKVNPKTPSIVSDVKTQLDVKPKLLKLNKKLDNKKDKHKQGKNKNLNEKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRND 260
            +VNAEG+WDVE+++             DD+  +   D     DD   P    SDD+ +   +E SDDE     SE ENE ++++  ESD+ S+     +   +   + G   K ++ D                         T++ + K P I S     +++KP+   +NK   NK DK    KNKNL +K+ ++KFKKD+ ESP  E KVVDP FITS GENYMSV EPR PDE KE H+QGNRK+RRA MFGHVPKIKPR D
Sbjct:  159 LVNAEGDWDVEEVK-----------KGDDNAAVGGDDDVDITDDDKAP----SDDENA---QEPSDDEYEHAASEDENEPSEQSEPESDAGSEHNVSGDESDDDDDNEGDGDKVVSQDEEENDEEVADFEQFVKAPPAKKVKKTEESSVKKPVIKS-----VEIKPRPDTINK---NKPDKKDTSKNKNLKQKIFNKKFKKDLDESPNLERKVVDPFFITSNGENYMSVAEPRQPDEFKEEHRQGNRKLRRAVMFGHVPKIKPRQD 398          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|1073529209|gb|JAT81716.1| (hypothetical protein g.2019, partial [Pectinophora gossypiella])

HSP 1 Score: 133.265 bits (334), Expect = 8.239e-35
Identity = 71/108 (65.74%), Postives = 81/108 (75.00%), Query Frame = 0
Query:  153 KTQLDVKPKLLKLNKKLDNKKDKHKQGKNKNLNEKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRND 260
            KTQ  +KP+   +NK   NK DK    KNKNL +K+ ++KFKKD+ ESP  E KVVDP FITS GENYMSV EPR PDE KE H+QGNRK+RRA MFGHVPKIKPR D
Sbjct:    5 KTQ--IKPRPDTINK---NKPDKKDTSKNKNLKQKIFNKKFKKDLDESPNLERKVVDPFFITSNGENYMSVAEPRQPDEFKEEHRQGNRKLRRAVMFGHVPKIKPRQD 107          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|909569632|ref|XP_013140326.1| (PREDICTED: serum response factor-binding protein 1 [Papilio polytes])

HSP 1 Score: 130.568 bits (327), Expect = 1.606e-31
Identity = 121/275 (44.00%), Postives = 152/275 (55.27%), Query Frame = 0
Query:    1 MKKEAKEKQKNKKKGKXAK-VVNAEGEWDVEDIEMTGNLNTDKNLSDDDDD--ELAEKDXCMDEDDGDEPRENISD--DDXSNEKEESSDDE-EMDQDSESENESNDENGKESDSESKIGEDSE-SDVETPSSTGK---LAKAITADTKKVNPKTPSIVSDVKTQLDVKPKLLKLNKKLDNKKDKHKQGKNKNLNEKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRNDNFAPD 265
            +KKEA+EKQ+NKKK K AK +VN EG+WDVEDI   G   T K + D+  D  +  + D   + D+G E  E  SD  +   N  +ESS DE + D DS+ E   + E      ++S+I  DS+ SD E   S  K   L K    D    + K P  V+  K                          KNKN NEK+L RKF KD+ E P  + K+VDP FIT+TGE+YMSVVEPR PDEVKEVH++GNRK RRA MFGHV   KPR + F  D
Sbjct:  138 LKKEAREKQQNKKKAKEAKKLVNIEGDWDVEDIGNKGT--TVKKVQDNGSDRKDTPDSDDGKESDEGSEIDEQQSDMVNAAHNSDDESSSDEPDNDLDSDEEALIDSEQSGSDINKSQIVSDSDNSDTEVKESKLKRKGLQKKEIEDNSNKSSKLPKEVNKKKKD----------------------VNKNKNFNEKILKRKFNKDIEEQPAEDIKMVDPFFITTTGESYMSVVEPRQPDEVKEVHQEGNRKYRRAVMFGHVQ--KPRRNEFKQD 386          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|827561297|ref|XP_012551453.1| (PREDICTED: ankyrin repeat domain-containing protein 12 [Bombyx mori])

HSP 1 Score: 126.331 bits (316), Expect = 5.437e-30
Identity = 54/72 (75.00%), Postives = 62/72 (86.11%), Query Frame = 0
Query:  191 RKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRNDNF 262
            RKFKKD   + + ENK+VDP FITSTGENYMSV EPR PDE KE+H+QGNRK+RRAAMFGHVPKIKPR +N+
Sbjct:  284 RKFKKDTDVTQLVENKIVDPFFITSTGENYMSVAEPRQPDEFKEIHRQGNRKLRRAAMFGHVPKIKPRRNNY 355          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|914556209|gb|KOB65601.1| (Serum response factor-binding protein 1, partial [Operophtera brumata])

HSP 1 Score: 122.094 bits (305), Expect = 4.088e-28
Identity = 113/293 (38.57%), Postives = 156/293 (53.24%), Query Frame = 0
Query:    1 MKKEAKEKQKNKKKGKXAKVVNAEGEWDVEDIEM-----------------TGNLNTDKNLSDD-DDDELAEKDXCMDEDDGDEPRENISDDDXSNEKEESSDDEEMDQDSESENESNDENGKESDSESKIGEDSESDVETPSSTGKLAKAI--TADTKKV----------NPKTPSI-----VSDVKTQLDVKPKLLKLNKKLDNKKDKHKQGKNKNLNEKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPR 258
            +KKEAK+ QKNKKKGK  KV+N++G+W+VE++EM                 + + N D+++S+D + D+    D   D+   ++  + ISDDD    ++  +D +E      SE E   EN  +        E+ E    +  + G+   +     DT+K+          +PKTP+      V  V   +DV    L   K       K K+ KNKNL EK+L+R FKKD   S + E KVVDP F T+TG +YMSV EPR PDEVKEVH QGNR+ RRAAMFG  P  KPR
Sbjct:  138 LKKEAKDAQKNKKKGKEGKVINSQGDWNVEEVEMGDDSKEISQNDDTSDDDSDDGNKDEDVSNDGNQDDCVSNDGNQDDHVSNDDSQEISDDDIPVTRQVVNDSDE-----SSEGEQTGENDDQDSIIDSDDENMEKQENSDDNQGQNNGSGDEIVDTRKLVELKPVKQTKSPKTPNFLIPKPVQPVTANIDV----LLKPKPKKKPDKKVKEHKNKNLIEKMLNRAFKKDADGSQIAE-KVVDPFFKTATGGSYMSVAEPRQPDEVKEVHMQGNRQERRAAMFGRAPN-KPR 419          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|768444383|ref|XP_011564040.1| (PREDICTED: MATH and LRR domain-containing protein PFE0570w [Plutella xylostella])

HSP 1 Score: 120.168 bits (300), Expect = 1.781e-27
Identity = 100/273 (36.63%), Postives = 141/273 (51.65%), Query Frame = 0
Query:   20 VVNAEGEWDVEDIEMTGNLNTDKNLSDDDDDELAEKDXCMDE-DDGDEPRENISDDDXSNEKEESSDD-------------EEMDQDSESENESNDENGKESDSE-SKIGEDSESDV-ETPSSTGKLAKAITADTKKVNPKTPSIVSDVKTQLDVKPKLLKLN-----------KKLDNKKDKHKQ----GKNKNLNEKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRNDN 261
             +  +G+W VED+ +  N    + + D+ DD+    D  MD+ +D  +  E  SD+D S +K   +D                 D+D   E +SN+    ESDS  S +  D+  DV ET                KV  K+P +  +     ++KP   KLN           +K DN+K   K+     K KN  EK++S+KFKKD+ E PV  NK+VDP F+T+TG+ YMS+ EPR PDE+ EVH+QGNR++RRA MFGH  K KPR  N
Sbjct:  161 AMKTDGDWKVEDLPLIPN----RTVMDEADDK---SDISMDDKNDASDLSEKESDNDYSLQKSSLNDSIDDDDDDADEDDDAHHDEDDNIEIDSNNLQKAESDSAASDLDNDTNEDVTET----------------KVQLKSPKLSEEP----NIKPSKSKLNGVKKPISAKKPQKEDNRKKLPKKVKENNKQKNFAEKIMSKKFKKDIDEKPVAGNKIVDPFFVTATGDKYMSLAEPRAPDEILEVHRQGNRQMRRAKMFGHELKFKPRKTN 406          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|930661144|gb|KPJ03080.1| (hypothetical protein RR46_06238 [Papilio xuthus])

HSP 1 Score: 117.472 bits (293), Expect = 1.489e-26
Identity = 53/77 (68.83%), Postives = 62/77 (80.52%), Query Frame = 0
Query:  186 EKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRNDNF 262
            EK+L RKF K + E PV E K+ DP FIT+TGE+YMSVVEPR PDEVKE+HKQGNR+ RRA MFGHVP  KPR ++F
Sbjct:  376 EKILKRKFNKVIDEKPVEEIKMADPFFITTTGESYMSVVEPRQPDEVKEIHKQGNRQYRRAVMFGHVP--KPRRNDF 450          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|910340093|ref|XP_013173708.1| (PREDICTED: serum response factor-binding protein 1 [Papilio xuthus])

HSP 1 Score: 115.546 bits (288), Expect = 5.168e-26
Identity = 52/77 (67.53%), Postives = 61/77 (79.22%), Query Frame = 0
Query:  186 EKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRNDNF 262
            EK+L RKF K + E P  E K+ DP FIT+TGE+YMSVVEPR PDEVKE+HKQGNR+ RRA MFGHVP  KPR ++F
Sbjct:  302 EKILKRKFNKVIDEKPAEEIKMADPFFITTTGESYMSVVEPRQPDEVKEIHKQGNRQYRRAVMFGHVP--KPRRNDF 376          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|943934448|ref|XP_014357833.1| (PREDICTED: serum response factor-binding protein 1 isoform X1 [Papilio machaon])

HSP 1 Score: 114.775 bits (286), Expect = 1.128e-25
Identity = 118/288 (40.97%), Postives = 161/288 (55.90%), Query Frame = 0
Query:    1 MKKEAKEKQKNKKKGKXAK-VVNAEGEWDVEDIEMTGNLNTDKNLSDDDDDELA----EKDXCMDEDDGDEPRENISDDDXSNEKEES-----SDDEEMDQDSESENE--SNDENGKESDSESKIGEDSESDVETPSSTGKLAKAITADTKKVNPKTPSIVSDV---KTQLDVKPKLLKLNKKLDNKKDKHKQGKNKNLN--------EKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRNDNFAPD 265
            MKKEA+EKQKNKKK K AK +VN EG+WDVE+I   G   TD   ++  ++ LA    + +   + D+G +     SDDD + E   S     SDDE +  DSE  +   +N +  K+SD       +S+S+V+         K I+   + ++    S V  +   K ++  K KL   NK ++ +K   K+   K  +        EK+L RKF K + E P  E K+ DP FIT+TGE+YMSVVEPR PDEVKEVHKQGNRK RRA MFG+VP   PR ++F  D
Sbjct:  138 MKKEAREKQKNKKKEKEAKKLVNIEGDWDVEEIVNKG---TDAVKANIHNNGLAMDNGQSEKGQESDNGQD-----SDDDPNIETPGSYDSTDSDDEALASDSEQADNVINNSQVAKDSD-------NSDSEVKESKVNKNKKKNISQKNEVIDNLNHSTVVSIDVNKDKISHKEKL-NGNKPVEKRKILSKEANKKKKDINKNKNFNEKILKRKFNKVIDEKPADEIKMADPFFITTTGESYMSVVEPRQPDEVKEVHKQGNRKYRRAVMFGNVP--IPRRNDFKQD 407          
BLAST of OSCA026007-RA vs. genbank:protein
Match: gi|943934450|ref|XP_014357841.1| (PREDICTED: uncharacterized G-patch domain protein DDB_G0278987 isoform X2 [Papilio machaon])

HSP 1 Score: 114.39 bits (285), Expect = 1.278e-25
Identity = 118/288 (40.97%), Postives = 161/288 (55.90%), Query Frame = 0
Query:    1 MKKEAKEKQKNKKKGKXAK-VVNAEGEWDVEDIEMTGNLNTDKNLSDDDDDELA----EKDXCMDEDDGDEPRENISDDDXSNEKEES-----SDDEEMDQDSESENE--SNDENGKESDSESKIGEDSESDVETPSSTGKLAKAITADTKKVNPKTPSIVSDV---KTQLDVKPKLLKLNKKLDNKKDKHKQGKNKNLN--------EKLLSRKFKKDVSESPVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFGHVPKIKPRNDNFAPD 265
            MKKEA+EKQKNKKK K AK +VN EG+WDVE+I   G   TD   ++  ++ LA    + +   + D+G +     SDDD + E   S     SDDE +  DSE  +   +N +  K+SD       +S+S+V+         K I+   + ++    S V  +   K ++  K KL   NK ++ +K   K+   K  +        EK+L RKF K + E P  E K+ DP FIT+TGE+YMSVVEPR PDEVKEVHKQGNRK RRA MFG+VP   PR ++F  D
Sbjct:  122 MKKEAREKQKNKKKEKEAKKLVNIEGDWDVEEIVNKG---TDAVKANIHNNGLAMDNGQSEKGQESDNGQD-----SDDDPNIETPGSYDSTDSDDEALASDSEQADNVINNSQVAKDSD-------NSDSEVKESKVNKNKKKNISQKNEVIDNLNHSTVVSIDVNKDKISHKEKL-NGNKPVEKRKILSKEANKKKKDINKNKNFNEKILKRKFNKVIDEKPADEIKMADPFFITTTGESYMSVVEPRQPDEVKEVHKQGNRKYRRAVMFGNVP--IPRRNDFKQD 391          
The following BLAST results are available for this feature:
BLAST of OSCA026007-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 14
Match NameE-valueIdentityDescription
gi|1073544495|gb|JAT89359.1|1.836e-3640.60hypothetical protein g.2020 [Pectinophora gossypie... [more]
gi|1073529209|gb|JAT81716.1|8.239e-3565.74hypothetical protein g.2019, partial [Pectinophora... [more]
gi|909569632|ref|XP_013140326.1|1.606e-3144.00PREDICTED: serum response factor-binding protein 1... [more]
gi|827561297|ref|XP_012551453.1|5.437e-3075.00PREDICTED: ankyrin repeat domain-containing protei... [more]
gi|914556209|gb|KOB65601.1|4.088e-2838.57Serum response factor-binding protein 1, partial [... [more]
gi|768444383|ref|XP_011564040.1|1.781e-2736.63PREDICTED: MATH and LRR domain-containing protein ... [more]
gi|930661144|gb|KPJ03080.1|1.489e-2668.83hypothetical protein RR46_06238 [Papilio xuthus][more]
gi|910340093|ref|XP_013173708.1|5.168e-2667.53PREDICTED: serum response factor-binding protein 1... [more]
gi|943934448|ref|XP_014357833.1|1.128e-2540.97PREDICTED: serum response factor-binding protein 1... [more]
gi|943934450|ref|XP_014357841.1|1.278e-2540.97PREDICTED: uncharacterized G-patch domain protein ... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 162..183
NoneNo IPR availableCOILSCoilCoilcoord: 18..27
NoneNo IPR availableCOILSCoilCoilcoord: 6..17

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_14744contignewscf_14744:2905..3702 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026007-RAOSCA026007-RAOstrinia scapulalismRNAnewscf_14744 2905..3702 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026007-PA ID=OSCA026007-PA|Name=OSCA026007-RA|organism=Ostrinia scapulalis|type=polypeptide|length=266bp
MKKEAKEKQKNKKKGKXAKVVNAEGEWDVEDIEMTGNLNTDKNLSDDDDD
ELAEKDXCMDEDDGDEPRENISDDDXSNEKEESSDDEEMDQDSESENESN
DENGKESDSESKIGEDSESDVETPSSTGKLAKAITADTKKVNPKTPSIVS
DVKTQLDVKPKLLKLNKKLDNKKDKHKQGKNKNLNEKLLSRKFKKDVSES
PVPENKVVDPXFITSTGENYMSVVEPRPPDEVKEVHKQGNRKIRRAAMFG
HVPKIKPRNDNFAPDN
back to top