OSCA026008-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026008-RA
Unique NameOSCA026008-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length153
Homology
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|827537700|ref|XP_012548129.1| (PREDICTED: lysosomal alpha-mannosidase-like [Bombyx mori])

HSP 1 Score: 154.836 bits (390), Expect = 8.859e-41
Identity = 75/152 (49.34%), Postives = 107/152 (70.39%), Query Frame = 0
Query:    3 GYGRNTKRIWMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKNDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSKD-KFLKSFNEAYG-SGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIVQYELVD 152
            GYG   K  W+   NE+SAL+ KLPLG+H+L++E WNE ++L+RLEN+LEK+DA+ SGIK V LR++F N R+  + E  L  N+ LKD+ PL W+K  +F++SFNE YG S +     ++ + + E  L KG+ LRPQQIRTF+V ++ VD
Sbjct:  712 GYGPYLKSKWLGETNEFSALKKKLPLGIHLLSIEQWNEATVLIRLENYLEKSDAIRSGIKRVYLRDVFVNLRIRSIAECALGGNVWLKDWSPLRWNKKTEFMRSFNEYYGRSNTSTVYADEPRMLSEGSLEKGLTLRPQQIRTFVVWFDYVD 863          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|357618463|gb|EHJ71432.1| (hypothetical protein KGM_06743 [Danaus plexippus])

HSP 1 Score: 139.813 bits (351), Expect = 1.060e-35
Identity = 67/139 (48.20%), Postives = 99/139 (71.22%), Query Frame = 0
Query:   12 WMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKNDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSKD-KFLKSFNEAYGSGSYA-YSNNDLKEMEETDLNKGIVLRPQQIRTFIVQY 148
            W+   NEYSAL++KLP+GVHILT++ WNE +LL+RLEN+LEK D + SG+K V+L++LF N    +  E  LAAN+ LKD+  + W ++  F+ +FN+ YG+   A +S   +K +++ D+  GI+L PQQIRTF+V Y
Sbjct:  529 WLGRRNEYSALKTKLPIGVHILTIQEWNERTLLIRLENYLEKVDVIKSGVKEVQLKDLFVNIVPDEAVEMKLAANIRLKDWTQIQWQRNGSFVSNFNDHYGTTKTAEFSYERMKPLKKVDVRAGILLYPQQIRTFVVSY 667          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|913324981|ref|XP_013193840.1| (PREDICTED: lysosomal alpha-mannosidase-like [Amyelois transitella])

HSP 1 Score: 132.88 bits (333), Expect = 5.171e-33
Identity = 77/154 (50.00%), Postives = 99/154 (64.29%), Query Frame = 0
Query:    4 YGRNTKRIWMEYNNEYSALRSKLPLGVHILTLETWNE--HSLLLRLENFLEKNDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSK-DKFLKSFNEAYGSGSYA-YSNNDLK-EMEETDLNKGIVLRPQQIRTFIVQYELVD 152
            YG ++K IW  + NE+SAL++KLP+GVHILTLE W      LLLRLEN+LEK DA+  G K V L+++F N ++  V E TL  NM L       W+K +KF+K+ N AYG+     Y N+D      E DLN GIVL PQQIRTF V+Y  V+
Sbjct: 1058 YGAHSKNIWKYHKNEFSALKTKLPIGVHILTLEKWGPTGEDLLLRLENYLEKTDALKKGNKRVFLQDMFVNLKLNSVAELTLGGNMWLNSTEKFLWNKRNKFVKNSNRAYGNNPVIDYDNDDFNIPNVELDLNSGIVLVPQQIRTFYVKYTYVE 1211          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|913325001|ref|XP_013193851.1| (PREDICTED: lysosomal alpha-mannosidase-like isoform X2 [Amyelois transitella])

HSP 1 Score: 97.8265 bits (242), Expect = 7.086e-21
Identity = 63/141 (44.68%), Postives = 85/141 (60.28%), Query Frame = 0
Query:   12 WMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKNDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGW-SKDKFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIVQYELV 151
            W+   NEYS L +KLP G+H+LTLE W E  LL+R EN  E   ++      V L  LF N +V  ++ETTLAAN +LKD+    W ++D+F +SFNE YG+      + D     E D  K I L+ +QIRTFIV+Y+ V
Sbjct:  968 WLNLKNEYSWLNNKLPDGLHLLTLEPWRE-DLLIRFENINEVESSL-----NVDLDKLFKNIKVKSLEETTLAANRLLKDYKKWEWMTEDRFSRSFNENYGNFKNKILSEDADLKNEDDGLK-INLKSKQIRTFIVKYDYV 1101          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|913325003|ref|XP_013193852.1| (PREDICTED: lysosomal alpha-mannosidase-like isoform X3 [Amyelois transitella])

HSP 1 Score: 97.8265 bits (242), Expect = 7.582e-21
Identity = 63/141 (44.68%), Postives = 85/141 (60.28%), Query Frame = 0
Query:   12 WMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKNDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGW-SKDKFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIVQYELV 151
            W+   NEYS L +KLP G+H+LTLE W E  LL+R EN  E   ++      V L  LF N +V  ++ETTLAAN +LKD+    W ++D+F +SFNE YG+      + D     E D  K I L+ +QIRTFIV+Y+ V
Sbjct:  968 WLNLKNEYSWLNNKLPDGLHLLTLEPWRE-DLLIRFENINEVESSL-----NVDLDKLFKNIKVKSLEETTLAANRLLKDYKKWEWMTEDRFSRSFNENYGNFKNKILSEDADLKNEDDGLK-INLKSKQIRTFIVKYDYV 1101          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|913324999|ref|XP_013193850.1| (PREDICTED: lysosomal alpha-mannosidase-like isoform X1 [Amyelois transitella])

HSP 1 Score: 97.8265 bits (242), Expect = 7.881e-21
Identity = 63/141 (44.68%), Postives = 85/141 (60.28%), Query Frame = 0
Query:   12 WMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKNDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGW-SKDKFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIVQYELV 151
            W+   NEYS L +KLP G+H+LTLE W E  LL+R EN  E   ++      V L  LF N +V  ++ETTLAAN +LKD+    W ++D+F +SFNE YG+      + D     E D  K I L+ +QIRTFIV+Y+ V
Sbjct:  968 WLNLKNEYSWLNNKLPDGLHLLTLEPWRE-DLLIRFENINEVESSL-----NVDLDKLFKNIKVKSLEETTLAANRLLKDYKKWEWMTEDRFSRSFNENYGNFKNKILSEDADLKNEDDGLK-INLKSKQIRTFIVKYDYV 1101          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|926615671|ref|XP_013772922.1| (PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-mannosidase-like, partial [Limulus polyphemus])

HSP 1 Score: 93.2041 bits (230), Expect = 2.916e-19
Identity = 57/142 (40.14%), Postives = 81/142 (57.04%), Query Frame = 0
Query:    8 TKRIWM-EYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKND--AVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSKDKFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIV 146
            ++R W  ++  E+S L+  LPL +H+LTLE W+ +S+LLRLE+F EK D    LS    V L+++F  F V +V ETTL AN +LKD   L W+K+          GS     SNND +       +  I L P +IRTF++
Sbjct:  799 SERDWAKQFRTEFSGLKLPLPLNIHLLTLEQWSGNSVLLRLEHFFEKTDHPGDLSKTTNVSLKDMFTPFNVANVTETTLGANQLLKDASRLTWNKE----------GSSP---SNNDRQRDAPKIPDFNITLNPMEIRTFVM 927          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|1004397135|gb|EFA08768.2| (Alpha-mannosidase 2-like Protein [Tribolium castaneum])

HSP 1 Score: 84.3445 bits (207), Expect = 3.980e-16
Identity = 54/139 (38.85%), Postives = 78/139 (56.12%), Query Frame = 0
Query:   10 RIWMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKN-DAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSKDKFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIVQ 147
            ++    N  +  L++ LP  VHILTLE W + S +LRLE+ LE N DA LS   TV L  LF  F +T+++ETTL AN    ++     ++DK++ +  +  GS   + SN +       DL   I L P QIRTFI++
Sbjct:  874 KVQSALNFNFEGLKTTLPDNVHILTLEPWKDDSYILRLEHILENNEDATLSTTATVNLEGLFTLFEITEIRETTLGANQWYDEYA----AEDKYIWALKD--GS---SVSNKEAPVTVTADLQ--ITLDPMQIRTFIIK 1001          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|237681164|ref|NP_001153727.1| (lysosomal alpha-mannosidase-like precursor [Tribolium castaneum] >gi|1004397134|gb|KYB25900.1| Alpha-mannosidase 2-like Protein [Tribolium castaneum])

HSP 1 Score: 84.3445 bits (207), Expect = 4.300e-16
Identity = 54/139 (38.85%), Postives = 78/139 (56.12%), Query Frame = 0
Query:   10 RIWMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEKN-DAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSKDKFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIVQ 147
            ++    N  +  L++ LP  VHILTLE W + S +LRLE+ LE N DA LS   TV L  LF  F +T+++ETTL AN    ++     ++DK++ +  +  GS   + SN +       DL   I L P QIRTFI++
Sbjct:  874 KVQSALNFNFEGLKTTLPDNVHILTLEPWKDDSYILRLEHILENNEDATLSTTATVNLEGLFTLFEITEIRETTLGANQWYDEYA----AEDKYIWALKD--GS---SVSNKEAPVTVTADLQ--ITLDPMQIRTFIIK 1001          
BLAST of OSCA026008-RA vs. genbank:protein
Match: gi|675382048|gb|KFM74950.1| (Lysosomal alpha-mannosidase, partial [Stegodyphus mimosarum])

HSP 1 Score: 83.1889 bits (204), Expect = 5.269e-16
Identity = 60/149 (40.27%), Postives = 82/149 (55.03%), Query Frame = 0
Query:   18 EYSALRSKLPLGVHILTLETWNEHSLLLRLENFLEK-NDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSKDKFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKG------------IVLRPQQIRTFIVQYELVDY 153
            E+ AL+ +LP  +H+LTLE  ++H +LLRLE+F EK +D  LS   TV L NLF  F+V   +ETTL+AN  L +   L W         NE  GS    YS+N L  + + D N+             I L+P +IRTFI++   VDY
Sbjct:  244 EFRALKRRLPQNIHVLTLERLDDHRILLRLEHFHEKYDDPNLSESVTVSLNNLFRPFKVIYYEETTLSANKYLYEAEKLNWP------VANEDNGS---EYSSNHLHRVLQADSNESFSMQDGEEGHLIITLKPMEIRTFILK---VDY 380          
The following BLAST results are available for this feature:
BLAST of OSCA026008-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827537700|ref|XP_012548129.1|8.859e-4149.34PREDICTED: lysosomal alpha-mannosidase-like [Bomby... [more]
gi|357618463|gb|EHJ71432.1|1.060e-3548.20hypothetical protein KGM_06743 [Danaus plexippus][more]
gi|913324981|ref|XP_013193840.1|5.171e-3350.00PREDICTED: lysosomal alpha-mannosidase-like [Amyel... [more]
gi|913325001|ref|XP_013193851.1|7.086e-2144.68PREDICTED: lysosomal alpha-mannosidase-like isofor... [more]
gi|913325003|ref|XP_013193852.1|7.582e-2144.68PREDICTED: lysosomal alpha-mannosidase-like isofor... [more]
gi|913324999|ref|XP_013193850.1|7.881e-2144.68PREDICTED: lysosomal alpha-mannosidase-like isofor... [more]
gi|926615671|ref|XP_013772922.1|2.916e-1940.14PREDICTED: LOW QUALITY PROTEIN: lysosomal alpha-ma... [more]
gi|1004397135|gb|EFA08768.2|3.980e-1638.85Alpha-mannosidase 2-like Protein [Tribolium castan... [more]
gi|237681164|ref|NP_001153727.1|4.300e-1638.85lysosomal alpha-mannosidase-like precursor [Tribol... [more]
gi|675382048|gb|KFM74950.1|5.269e-1640.27Lysosomal alpha-mannosidase, partial [Stegodyphus ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0005975 carbohydrate metabolic process
biological_process GO:0006013 mannose metabolic process
biological_process GO:0008152 metabolic process
molecular_function GO:0005488 binding
molecular_function GO:0030246 carbohydrate binding
molecular_function GO:0003824 catalytic activity
molecular_function GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
molecular_function GO:0015923 mannosidase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D2.60.40.1360coord: 15..149
e-value: 4.2E-29
score: 100.7
NoneNo IPR availablePANTHERPTHR11607:SF3LYSOSOMAL ALPHA-MANNOSIDASEcoord: 13..113
NoneNo IPR availablePANTHERPTHR11607:SF3LYSOSOMAL ALPHA-MANNOSIDASEcoord: 131..153
NoneNo IPR availablePANTHERPTHR11607ALPHA-MANNOSIDASEcoord: 13..113
NoneNo IPR availablePANTHERPTHR11607ALPHA-MANNOSIDASEcoord: 131..153
IPR011682Glycosyl hydrolase family 38, C-terminalPFAMPF07748Glyco_hydro_38Ccoord: 20..145
e-value: 3.1E-7
score: 29.4
IPR011013Galactose mutarotase-like domainSUPERFAMILY74650Galactose mutarotase-likecoord: 9..97
coord: 134..148

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19383contignewscf_19383:98..559 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026008-RAOSCA026008-RAOstrinia scapulalismRNAnewscf_19383 98..559 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026008-PA ID=OSCA026008-PA|Name=OSCA026008-RA|organism=Ostrinia scapulalis|type=polypeptide|length=153bp
MYGYGRNTKRIWMEYNNEYSALRSKLPLGVHILTLETWNEHSLLLRLENF
LEKNDAVLSGIKTVKLRNLFXNFRVTDVKETTLAANMMLKDFVPLGWSKD
KFLKSFNEAYGSGSYAYSNNDLKEMEETDLNKGIVLRPQQIRTFIVQYEL
VDY
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0015923mannosidase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR011013Gal_mutarotase_SF_dom
IPR011682Glyco_hydro_38_C