OSCA026009-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026009-RA
Unique NameOSCA026009-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length77
Homology
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 89.3521 bits (220), Expect = 4.753e-22
Identity = 42/56 (75.00%), Postives = 49/56 (87.50%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VLEWRPRTG+RSVGRPP RWTDDL+KVA   WM+ A +RSSW+SL EA+VQQWAS+
Sbjct:    9 VLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASH 64          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 89.3521 bits (220), Expect = 8.833e-22
Identity = 41/56 (73.21%), Postives = 48/56 (85.71%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VLEWRPRTG+RSVGRPP RWTDDL+KVA   WM+ A +RSSW+SL EA+ QQWAS+
Sbjct:   26 VLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASH 81          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 88.5817 bits (218), Expect = 1.478e-20
Identity = 40/57 (70.18%), Postives = 48/57 (84.21%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASYD 77
            VLEWRPRTGKRSVGRPP RWTDD++K A + WM+ A++R+ WKSL EA+VQQW SY 
Sbjct:  104 VLEWRPRTGKRSVGRPPARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSYG 160          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|930654247|gb|KPI96582.1| (hypothetical protein RR46_12612 [Papilio xuthus])

HSP 1 Score: 84.3445 bits (207), Expect = 4.175e-20
Identity = 40/56 (71.43%), Postives = 47/56 (83.93%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VLEWRP TG+RSVGRPP RWTDDL+KVA   WM+ A +RSSW+SL EA+ QQWAS+
Sbjct:    9 VLEWRPWTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASH 64          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|930681026|gb|KPJ20566.1| (hypothetical protein RR46_00054, partial [Papilio xuthus])

HSP 1 Score: 84.3445 bits (207), Expect = 4.221e-20
Identity = 38/56 (67.86%), Postives = 45/56 (80.36%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VLEWRPRTG+RSVGRPP RWTDDL+K+    WMQ A +R SW+SL EA+ QQW +Y
Sbjct:    9 VLEWRPRTGRRSVGRPPARWTDDLVKITGATWMQLAQDRLSWRSLGEAYAQQWVTY 64          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 90.5077 bits (223), Expect = 6.989e-20
Identity = 41/56 (73.21%), Postives = 45/56 (80.36%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VLEWRPR G+RSVGRPP RWTDDL+KVA   WMQ A +RS WKSL EA VQQW S+
Sbjct:  307 VLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 362          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 90.8929 bits (224), Expect = 1.167e-19
Identity = 41/56 (73.21%), Postives = 45/56 (80.36%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VLEWRPR G+RSVGRPP RWTDDL+KVA   WMQ A +RS WKSL EA VQQW S+
Sbjct:  422 VLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 477          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|930656813|gb|KPI99136.1| (hypothetical protein RR46_02353 [Papilio xuthus])

HSP 1 Score: 83.5741 bits (205), Expect = 1.174e-19
Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VL WRPRTG+RSVGRPP RWTDDL+KVA   WMQ   +RSSW+S  EA+ QQWAS+
Sbjct:   15 VLVWRPRTGRRSVGRPPARWTDDLVKVAGASWMQVTQDRSSWRSWGEAYAQQWASH 70          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 90.5077 bits (223), Expect = 1.272e-19
Identity = 41/56 (73.21%), Postives = 45/56 (80.36%), Query Frame = 0
Query:   21 VLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWASY 76
            VLEWRPR G+RSVGRPP RWTDDL+KVA   WMQ A +RS WKSL EA VQQW S+
Sbjct:  441 VLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSF 496          
BLAST of OSCA026009-RA vs. genbank:protein
Match: gi|930669265|gb|KPJ10168.1| (hypothetical protein RR48_04991 [Papilio machaon])

HSP 1 Score: 81.6481 bits (200), Expect = 3.973e-19
Identity = 38/55 (69.09%), Postives = 46/55 (83.64%), Query Frame = 0
Query:   20 VVLEWRPRTGKRSVGRPPLRWTDDLMKVAERCWMQTAANRSSWKSLEEAHVQQWA 74
            +VLEW+PRTG+RSVGRP  RWTDDL+KVA   WM+ A +RSSW+SL EA+ QQWA
Sbjct:    1 MVLEWQPRTGRRSVGRPSARWTDDLVKVARVSWMRVAQDRSSWRSLGEAYAQQWA 55          
The following BLAST results are available for this feature:
BLAST of OSCA026009-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930681186|gb|KPJ20726.1|4.753e-2275.00hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|930648975|gb|KPI91323.1|8.833e-2273.21hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|825740785|ref|WP_047149388.1|1.478e-2070.18hypothetical protein, partial [Escherichia coli][more]
gi|930654247|gb|KPI96582.1|4.175e-2071.43hypothetical protein RR46_12612 [Papilio xuthus][more]
gi|930681026|gb|KPJ20566.1|4.221e-2067.86hypothetical protein RR46_00054, partial [Papilio ... [more]
gi|134001247|gb|ABO45233.1|6.989e-2073.21reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001215|gb|ABO45231.1|1.167e-1973.21reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|930656813|gb|KPI99136.1|1.174e-1969.64hypothetical protein RR46_02353 [Papilio xuthus][more]
gi|134001323|gb|ABO45239.1|1.272e-1973.21reverse transcriptase [Ostrinia nubilalis][more]
gi|930669265|gb|KPJ10168.1|3.973e-1969.09hypothetical protein RR48_04991 [Papilio machaon][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_24852contignewscf_24852:952..1182 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026009-RAOSCA026009-RAOstrinia scapulalismRNAnewscf_24852 952..1182 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026009-PA ID=OSCA026009-PA|Name=OSCA026009-RA|organism=Ostrinia scapulalis|type=polypeptide|length=77bp
PIVRDHVSEPYIITSNTLLVVLEWRPRTGKRSVGRPPLRWTDDLMKVAER
CWMQTAANRSSWKSLEEAHVQQWASYD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity