OSCA026010-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026010-RA
Unique NameOSCA026010-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length106
Homology
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|838097683|gb|KLV34197.1| (hypothetical protein AB894_15350, partial [Piscirickettsia salmonis])

HSP 1 Score: 125.561 bits (314), Expect = 2.769e-31
Identity = 57/93 (61.29%), Postives = 72/93 (77.42%), Query Frame = 0
Query:    9 EASHQELDHSRKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYILA 101
            EA  Q L+H RKVASL+VFYR+HFGECA ELH+LIPP+PFHHR TR+    H ++VDIPPT  K F + F++RTAR+WNSLP ++F + Y L 
Sbjct:  612 EARLQSLEHRRKVASLSVFYRIHFGECAGELHNLIPPSPFHHRTTRQSARRHRFMVDIPPTRTKRFASSFLVRTAREWNSLPESVFPDGYNLG 704          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|357626766|gb|EHJ76717.1| (reverse transcriptase [Danaus plexippus])

HSP 1 Score: 87.4261 bits (215), Expect = 4.610e-20
Identity = 40/75 (53.33%), Postives = 54/75 (72.00%), Query Frame = 0
Query:   14 ELDHSRKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNS 88
             L+  +KVASL+VFYR+H G+CA ELHDL P +PF+HR TRR ++ HP++VDI     K + + F+ RTA D NS
Sbjct:   53 SLEQRQKVASLSVFYRIHSGQCACELHDLFPASPFYHRITRRTVSLHPFVVDIARILMKLYASSFLRRTAMDGNS 127          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|910353923|ref|XP_013181000.1| (PREDICTED: uncharacterized protein LOC106127467 [Papilio xuthus])

HSP 1 Score: 78.9518 bits (193), Expect = 8.913e-16
Identity = 33/51 (64.71%), Postives = 42/51 (82.35%), Query Frame = 0
Query:   15 LDHSRKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVD 65
            L+H RKVA L+VFYRLHFGECA+ELH+LIPP+PF+HR  R     HP++V+
Sbjct:  177 LEHRRKVARLSVFYRLHFGECAQELHELIPPSPFYHRTFRHTAGIHPFVVE 227          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|943946887|ref|XP_014356596.1| (PREDICTED: uncharacterized protein LOC106709329 [Papilio machaon])

HSP 1 Score: 75.485 bits (184), Expect = 1.951e-14
Identity = 40/85 (47.06%), Postives = 52/85 (61.18%), Query Frame = 0
Query:   19 RKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYILASS 103
            R V+SL +FYRL+ GEC+ EL   IP A F HR TR+   YHPY +D   +    F   F+ RTA  WNSL +A+F  HY L ++
Sbjct:  142 RDVSSLCIFYRLYHGECSDELFGTIPAAEFCHRTTRQTARYHPYHLDGWHSTTVRFSRNFLPRTAALWNSLSSAVFPNHYDLGAA 226          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|910347296|ref|XP_013177579.1| (PREDICTED: uncharacterized protein LOC106125039 [Papilio xuthus])

HSP 1 Score: 69.707 bits (169), Expect = 1.417e-12
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 0
Query:   19 RKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYILASSRQE 106
            R V+SL +FYR++ GEC++EL   IP A F HR TR+   +HP+ +D   +    F   F+ RTA  WN L +A+F   Y L S ++ 
Sbjct:   79 RDVSSLCIFYRIYHGECSEELFGTIPAAEFRHRTTRQAARFHPHHLDGWHSTTVRFSRNFLPRTATLWNGLSSAVFPNQYDLGSFKKR 166          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|357624391|gb|EHJ75178.1| (reverse transcriptase [Danaus plexippus])

HSP 1 Score: 68.1662 bits (165), Expect = 1.581e-12
Identity = 29/75 (38.67%), Postives = 49/75 (65.33%), Query Frame = 0
Query:   32 FGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYILASSRQE 106
            +G+ A ELH+LIP +PF++R T+  +  +P++++ P    K + + F+MRTARDWNSL  + F   Y L   +++
Sbjct:   45 YGKGAWELHNLIPASPFYNRTTKCTVGLYPFVLNFPRIRTKRYVSSFLMRTARDWNSLLVSEFLSSYNLGVFKKK 119          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|509160285|gb|JAA78263.1| (reverse transcriptase, partial [Pararge aegeria])

HSP 1 Score: 67.0106 bits (162), Expect = 1.727e-12
Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 0
Query:    3 LGGTTSEASHQELDHSRKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRR 56
            +G     +  Q L+H RKVA L VFY++HFGECA+EL DL+ P+PF+HR  R R
Sbjct:   30 IGNDLVVSRLQSLEHRRKVACLAVFYKIHFGECAQELFDLVKPSPFYHRTARHR 83          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|910319275|ref|XP_013162491.1| (PREDICTED: uncharacterized protein LOC106113978 [Papilio xuthus])

HSP 1 Score: 68.9366 bits (167), Expect = 6.632e-12
Identity = 36/88 (40.91%), Postives = 51/88 (57.95%), Query Frame = 0
Query:   19 RKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYILASSRQE 106
            R V+SL +FYR++ GEC++EL   IP A F HR TR+   +HP+  D   +    F   F+ RTA  WN L +A+F   Y L S ++ 
Sbjct:  133 RDVSSLCIFYRIYHGECSEELFGTIPAAEFRHRTTRQTARFHPHHFDGWQSTTVRFARNFLPRTAALWNGLSSAVFPNRYDLGSFKKR 220          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|910317225|ref|XP_013161376.1| (PREDICTED: uncharacterized protein LOC106113188, partial [Papilio xuthus])

HSP 1 Score: 68.9366 bits (167), Expect = 7.450e-12
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 0
Query:   19 RKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYILASSRQE 106
            R V+SL +FYR++ GEC++EL   IP A F HR TR+   +HP+ +D   +    F   F+ RTA  WN L +A+F   Y L S ++ 
Sbjct:  143 RDVSSLCIFYRIYHGECSEELFGTIPAAEFRHRTTRQTARFHPHHLDGWHSTRVRFSRNFLPRTAALWNGLSSAVFPNQYDLGSFKKR 230          
BLAST of OSCA026010-RA vs. genbank:protein
Match: gi|57506562|dbj|BAD86652.1| (reverse transcriptase, partial [Bombyx mori])

HSP 1 Score: 68.1662 bits (165), Expect = 1.225e-11
Identity = 33/89 (37.08%), Postives = 50/89 (56.18%), Query Frame = 0
Query:   13 QELDHSRKVASLTVFYRLHFGECAKELHDLIPPAPFHHRGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYILA 101
            + L   R   SL + YR+  GEC++EL ++IP + F+HR  R R   HPY ++   +    F   F+ RT R WN LP+ +F E Y ++
Sbjct:  122 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMS 210          
The following BLAST results are available for this feature:
BLAST of OSCA026010-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 15
Match NameE-valueIdentityDescription
gi|838097683|gb|KLV34197.1|2.769e-3161.29hypothetical protein AB894_15350, partial [Pisciri... [more]
gi|357626766|gb|EHJ76717.1|4.610e-2053.33reverse transcriptase [Danaus plexippus][more]
gi|910353923|ref|XP_013181000.1|8.913e-1664.71PREDICTED: uncharacterized protein LOC106127467 [P... [more]
gi|943946887|ref|XP_014356596.1|1.951e-1447.06PREDICTED: uncharacterized protein LOC106709329 [P... [more]
gi|910347296|ref|XP_013177579.1|1.417e-1240.91PREDICTED: uncharacterized protein LOC106125039 [P... [more]
gi|357624391|gb|EHJ75178.1|1.581e-1238.67reverse transcriptase [Danaus plexippus][more]
gi|509160285|gb|JAA78263.1|1.727e-1253.70reverse transcriptase, partial [Pararge aegeria][more]
gi|910319275|ref|XP_013162491.1|6.632e-1240.91PREDICTED: uncharacterized protein LOC106113978 [P... [more]
gi|910317225|ref|XP_013161376.1|7.450e-1240.91PREDICTED: uncharacterized protein LOC106113188, p... [more]
gi|57506562|dbj|BAD86652.1|1.225e-1137.08reverse transcriptase, partial [Bombyx mori][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090304 nucleic acid metabolic process
molecular_function GO:0003824 catalytic activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_44579contignewscf_44579:579..899 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026010-RAOSCA026010-RAOstrinia scapulalismRNAnewscf_44579 579..899 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026010-PA ID=OSCA026010-PA|Name=OSCA026010-RA|organism=Ostrinia scapulalis|type=polypeptide|length=106bp
MYLGGTTSEASHQELDHSRKVASLTVFYRLHFGECAKELHDLIPPAPFHH
RGTRRRLAYHPYIVDIPPTHAKCFDNFFIMRTARDWNSLPAALFAEHYIL
ASSRQE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0090304nucleic acid metabolic process