OSCA026011-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026011-RA
Unique NameOSCA026011-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length108
Homology
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|910347296|ref|XP_013177579.1| (PREDICTED: uncharacterized protein LOC106125039 [Papilio xuthus])

HSP 1 Score: 132.88 bits (333), Expect = 3.565e-37
Identity = 65/85 (76.47%), Postives = 72/85 (84.71%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTRQ--HFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKRRAYLHL 89
            YR+YHGECSEEL G IPAA FRHR+TRQ   F+PHHL DGW +TTVRFSRNFLPRT  LWNGLSSAVFP+ YDL +FK+RAY HL
Sbjct:   88 YRIYHGECSEELFGTIPAAEFRHRTTRQAARFHPHHL-DGWHSTTVRFSRNFLPRTATLWNGLSSAVFPNQYDLGSFKKRAYHHL 171          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|910319275|ref|XP_013162491.1| (PREDICTED: uncharacterized protein LOC106113978 [Papilio xuthus])

HSP 1 Score: 133.65 bits (335), Expect = 8.009e-37
Identity = 64/85 (75.29%), Postives = 72/85 (84.71%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTRQ--HFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKRRAYLHL 89
            YR+YHGECSEEL G IPAA FRHR+TRQ   F+PHH  DGWQ+TTVRF+RNFLPRT  LWNGLSSAVFP+ YDL +FK+RAY HL
Sbjct:  142 YRIYHGECSEELFGTIPAAEFRHRTTRQTARFHPHHF-DGWQSTTVRFARNFLPRTAALWNGLSSAVFPNRYDLGSFKKRAYHHL 225          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|910317225|ref|XP_013161376.1| (PREDICTED: uncharacterized protein LOC106113188, partial [Papilio xuthus])

HSP 1 Score: 131.339 bits (329), Expect = 7.719e-36
Identity = 64/85 (75.29%), Postives = 71/85 (83.53%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTRQ--HFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKRRAYLHL 89
            YR+YHGECSEEL G IPAA FRHR+TRQ   F+PHHL DGW +T VRFSRNFLPRT  LWNGLSSAVFP+ YDL +FK+RAY HL
Sbjct:  152 YRIYHGECSEELFGTIPAAEFRHRTTRQTARFHPHHL-DGWHSTRVRFSRNFLPRTAALWNGLSSAVFPNQYDLGSFKKRAYHHL 235          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|223268545|emb|CAX36785.1| (hypothetical protein [Papilio dardanus])

HSP 1 Score: 123.25 bits (308), Expect = 4.329e-33
Identity = 61/85 (71.76%), Postives = 69/85 (81.18%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTRQ--HFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKRRAYLHL 89
            YR+YHGECSEEL G IPAA FRHR++RQ  +F+ HHL DGW +TT RFSRNFLPRT  LWN LSSAVFP+ YDL AFK+RAY  L
Sbjct:  110 YRLYHGECSEELFGTIPAAEFRHRTSRQSANFHRHHL-DGWHSTTTRFSRNFLPRTAALWNTLSSAVFPNVYDLGAFKKRAYSSL 193          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|943946887|ref|XP_014356596.1| (PREDICTED: uncharacterized protein LOC106709329 [Papilio machaon])

HSP 1 Score: 110.923 bits (276), Expect = 5.547e-28
Identity = 54/76 (71.05%), Postives = 62/76 (81.58%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTRQ--HFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQA 80
            YR+YHGECS+EL G IPAA F HR+TRQ   ++P+HL DGW +TTVRFSRNFLPRT  LWN LSSAVFP+ YDL A
Sbjct:  151 YRLYHGECSDELFGTIPAAEFCHRTTRQTARYHPYHL-DGWHSTTVRFSRNFLPRTAALWNSLSSAVFPNHYDLGA 225          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|512899552|ref|XP_004924674.1| (PREDICTED: uncharacterized protein LOC101745997 [Bombyx mori])

HSP 1 Score: 109.768 bits (273), Expect = 7.480e-28
Identity = 50/83 (60.24%), Postives = 66/83 (79.52%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTRQHFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKRRAYLHL 89
            YR+Y+GECSEEL  LI AA F +RS+R++++PHHL DGW++TT+RF  +FLPRT  LWN L SAVFP+  D+  FK+RAY +L
Sbjct:  110 YRIYNGECSEELFNLIEAADFSNRSSRRNYHPHHL-DGWRSTTMRFKNSFLPRTVNLWNSLPSAVFPNNCDIGLFKKRAYSYL 191          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|433339045|dbj|BAM73877.1| (cytochrome P450, partial [Bombyx mori])

HSP 1 Score: 88.5817 bits (218), Expect = 1.038e-20
Identity = 43/79 (54.43%), Postives = 58/79 (73.42%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTR--QHFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKR 83
            YRM+HGECSEEL  +IPA+ F HR+ R     +P++L +  +++TVRF R+FLPRT +LWN L S VFP+ YD+  FKR
Sbjct:    1 YRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYL-EPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKR 78          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|57506562|dbj|BAD86652.1| (reverse transcriptase, partial [Bombyx mori])

HSP 1 Score: 89.7373 bits (221), Expect = 8.973e-20
Identity = 43/79 (54.43%), Postives = 58/79 (73.42%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTR--QHFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKR 83
            YRM+HGECSEEL  +IPA+ F HR+ R     +P++L +  +++TVRF R+FLPRT +LWN L S VFP+ YD+  FKR
Sbjct:  137 YRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYL-EPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKR 214          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|34099638|gb|AAQ57129.1| (endonuclease and reverse transcriptase-like protein [Bombyx mori])

HSP 1 Score: 88.9669 bits (219), Expect = 1.742e-18
Identity = 43/79 (54.43%), Postives = 58/79 (73.42%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTR--QHFYPHHLVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKR 83
            YRM+HGECSEEL  +IPA+ F HR+ R     +P++L +  +++TVRF R+FLPRT +LWN L S VFP+ YD+  FKR
Sbjct:  884 YRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYL-EPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKR 961          
BLAST of OSCA026011-RA vs. genbank:protein
Match: gi|838097683|gb|KLV34197.1| (hypothetical protein AB894_15350, partial [Piscirickettsia salmonis])

HSP 1 Score: 76.2554 bits (186), Expect = 5.654e-14
Identity = 43/91 (47.25%), Postives = 54/91 (59.34%), Query Frame = 0
Query:    7 YRMYHGECSEELSGLIPAATFRHRSTRQHFYPHH-LVDGWQATTVRFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKRRAYLHLLKAGNAP 96
            YR++ GEC+ EL  LIP + F HR+TRQ    H  +VD     T RF+ +FL RT + WN L  +VFPDGY+L  FK R    LL    AP
Sbjct:  631 YRIHFGECAGELHNLIPPSPFHHRTTRQSARRHRFMVDIPPTRTKRFASSFLVRTAREWNSLPESVFPDGYNLGVFKARVN-RLLMGRRAP 720          
The following BLAST results are available for this feature:
BLAST of OSCA026011-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 11
Match NameE-valueIdentityDescription
gi|910347296|ref|XP_013177579.1|3.565e-3776.47PREDICTED: uncharacterized protein LOC106125039 [P... [more]
gi|910319275|ref|XP_013162491.1|8.009e-3775.29PREDICTED: uncharacterized protein LOC106113978 [P... [more]
gi|910317225|ref|XP_013161376.1|7.719e-3675.29PREDICTED: uncharacterized protein LOC106113188, p... [more]
gi|223268545|emb|CAX36785.1|4.329e-3371.76hypothetical protein [Papilio dardanus][more]
gi|943946887|ref|XP_014356596.1|5.547e-2871.05PREDICTED: uncharacterized protein LOC106709329 [P... [more]
gi|512899552|ref|XP_004924674.1|7.480e-2860.24PREDICTED: uncharacterized protein LOC101745997 [B... [more]
gi|433339045|dbj|BAM73877.1|1.038e-2054.43cytochrome P450, partial [Bombyx mori][more]
gi|57506562|dbj|BAD86652.1|8.973e-2054.43reverse transcriptase, partial [Bombyx mori][more]
gi|34099638|gb|AAQ57129.1|1.742e-1854.43endonuclease and reverse transcriptase-like protei... [more]
gi|838097683|gb|KLV34197.1|5.654e-1447.25hypothetical protein AB894_15350, partial [Pisciri... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090304 nucleic acid metabolic process
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0003824 catalytic activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25305contignewscf_25305:779..1102 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026011-RAOSCA026011-RAOstrinia scapulalismRNAnewscf_25305 779..1102 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026011-PA ID=OSCA026011-PA|Name=OSCA026011-RA|organism=Ostrinia scapulalis|type=polypeptide|length=108bp
VKVNRHYRMYHGECSEELSGLIPAATFRHRSTRQHFYPHHLVDGWQATTV
RFSRNFLPRTTKLWNGLSSAVFPDGYDLQAFKRRAYLHLLKAGNAPVTPL
GLRVSMGD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Biological Process
TermDefinition
GO:0090304nucleic acid metabolic process