OSCA026015-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026015-RA
Unique NameOSCA026015-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length66
Homology
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|827539890|ref|XP_012553061.1| (PREDICTED: LIM domain only protein 7 isoform X3 [Bombyx mori])

HSP 1 Score: 126.331 bits (316), Expect = 2.995e-32
Identity = 61/67 (91.04%), Postives = 64/67 (95.52%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP-KIEIQEDWQS 66
            TTDSADFLATR HTAAVIPGKPAANPLQF+RVGPADLGSRAREQLRRAELAK+TEP K+E QEDWQS
Sbjct:   36 TTDSADFLATRPHTAAVIPGKPAANPLQFIRVGPADLGSRAREQLRRAELAKKTEPAKLERQEDWQS 102          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|913311057|ref|XP_013186192.1| (PREDICTED: uncharacterized protein LOC106131594 isoform X2 [Amyelois transitella])

HSP 1 Score: 124.02 bits (310), Expect = 1.547e-31
Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP--KIEIQEDWQS 66
            TTDSADFLATR HTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAK+TEP  + E QEDWQS
Sbjct:   36 TTDSADFLATRPHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKKTEPAARFERQEDWQS 103          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|913311053|ref|XP_013186190.1| (PREDICTED: uncharacterized protein LOC106131594 isoform X1 [Amyelois transitella] >gi|913311055|ref|XP_013186191.1| PREDICTED: uncharacterized protein LOC106131594 isoform X1 [Amyelois transitella])

HSP 1 Score: 124.02 bits (310), Expect = 1.739e-31
Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP--KIEIQEDWQS 66
            TTDSADFLATR HTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAK+TEP  + E QEDWQS
Sbjct:   36 TTDSADFLATRPHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKKTEPAARFERQEDWQS 103          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|913311059|ref|XP_013186193.1| (PREDICTED: uncharacterized protein LOC106131594 isoform X3 [Amyelois transitella])

HSP 1 Score: 124.02 bits (310), Expect = 1.972e-31
Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP--KIEIQEDWQS 66
            TTDSADFLATR HTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAK+TEP  + E QEDWQS
Sbjct:   36 TTDSADFLATRPHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKKTEPAARFERQEDWQS 103          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|357614053|gb|EHJ68878.1| (hypothetical protein KGM_01468 [Danaus plexippus])

HSP 1 Score: 116.316 bits (290), Expect = 1.121e-30
Identity = 56/67 (83.58%), Postives = 64/67 (95.52%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP-KIEIQEDWQS 66
            T+DSADFLATR HTA+V+PGKPAANPLQFV+VGPADLG++AREQLRRAELAK+TEP +IE QEDWQS
Sbjct:   80 TSDSADFLATRPHTASVLPGKPAANPLQFVKVGPADLGTKAREQLRRAELAKKTEPARIERQEDWQS 146          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|768426748|ref|XP_011554429.1| (PREDICTED: uncharacterized protein LOC105385707 [Plutella xylostella])

HSP 1 Score: 120.553 bits (301), Expect = 2.997e-30
Identity = 57/67 (85.07%), Postives = 62/67 (92.54%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP-KIEIQEDWQS 66
            ++DSADFLATR HTAAVIPGKP  NPLQFV+VGPADLGSRAREQLRRAELAKRTEP ++E QEDWQS
Sbjct:   37 SSDSADFLATRPHTAAVIPGKPVVNPLQFVKVGPADLGSRAREQLRRAELAKRTEPARVEQQEDWQS 103          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|914565758|gb|KOB70652.1| (Uncharacterized protein OBRU01_15332, partial [Operophtera brumata])

HSP 1 Score: 107.842 bits (268), Expect = 3.787e-29
Identity = 54/61 (88.52%), Postives = 56/61 (91.80%), Query Frame = 0
Query:    7 FLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP-KIEIQEDWQS 66
            FLA R HTAAV+PGKPA NPLQFVRVGPADLGSRAREQLRRAELAKRTEP +IE QEDWQS
Sbjct:    1 FLAVRPHTAAVLPGKPAGNPLQFVRVGPADLGSRAREQLRRAELAKRTEPARIERQEDWQS 61          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|827539888|ref|XP_004923285.2| (PREDICTED: LIM domain only protein 7 isoform X2 [Bombyx mori])

HSP 1 Score: 114.39 bits (285), Expect = 4.099e-28
Identity = 61/67 (91.04%), Postives = 64/67 (95.52%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP-KIEIQEDWQS 66
            TTDSADFLATR HTAAVIPGKPAANPLQF+RVGPADLGSRAREQLRRAELAK+TEP K+E QEDWQS
Sbjct:   36 TTDSADFLATRPHTAAVIPGKPAANPLQFIRVGPADLGSRAREQLRRAELAKKTEPAKLERQEDWQS 102          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|827539882|ref|XP_012553059.1| (PREDICTED: LIM domain only protein 7 isoform X1 [Bombyx mori] >gi|827539884|ref|XP_004923286.2| PREDICTED: LIM domain only protein 7 isoform X1 [Bombyx mori] >gi|827539886|ref|XP_012553060.1| PREDICTED: LIM domain only protein 7 isoform X1 [Bombyx mori])

HSP 1 Score: 114.39 bits (285), Expect = 4.099e-28
Identity = 61/67 (91.04%), Postives = 64/67 (95.52%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP-KIEIQEDWQS 66
            TTDSADFLATR HTAAVIPGKPAANPLQF+RVGPADLGSRAREQLRRAELAK+TEP K+E QEDWQS
Sbjct:   36 TTDSADFLATRPHTAAVIPGKPAANPLQFIRVGPADLGSRAREQLRRAELAKKTEPAKLERQEDWQS 102          
BLAST of OSCA026015-RA vs. genbank:protein
Match: gi|913311061|ref|XP_013186194.1| (PREDICTED: uncharacterized protein LOC106131594 isoform X4 [Amyelois transitella])

HSP 1 Score: 112.849 bits (281), Expect = 1.509e-27
Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
Query:    1 TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKRTEP--KIEIQEDWQS 66
            TTDSADFLATR HTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAK+TEP  + E QEDWQS
Sbjct:   36 TTDSADFLATRPHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAELAKKTEPAARFERQEDWQS 103          
The following BLAST results are available for this feature:
BLAST of OSCA026015-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827539890|ref|XP_012553061.1|2.995e-3291.04PREDICTED: LIM domain only protein 7 isoform X3 [B... [more]
gi|913311057|ref|XP_013186192.1|1.547e-3189.71PREDICTED: uncharacterized protein LOC106131594 is... [more]
gi|913311053|ref|XP_013186190.1|1.739e-3189.71PREDICTED: uncharacterized protein LOC106131594 is... [more]
gi|913311059|ref|XP_013186193.1|1.972e-3189.71PREDICTED: uncharacterized protein LOC106131594 is... [more]
gi|357614053|gb|EHJ68878.1|1.121e-3083.58hypothetical protein KGM_01468 [Danaus plexippus][more]
gi|768426748|ref|XP_011554429.1|2.997e-3085.07PREDICTED: uncharacterized protein LOC105385707 [P... [more]
gi|914565758|gb|KOB70652.1|3.787e-2988.52Uncharacterized protein OBRU01_15332, partial [Ope... [more]
gi|827539888|ref|XP_004923285.2|4.099e-2891.04PREDICTED: LIM domain only protein 7 isoform X2 [B... [more]
gi|827539882|ref|XP_012553059.1|4.099e-2891.04PREDICTED: LIM domain only protein 7 isoform X1 [B... [more]
gi|913311061|ref|XP_013186194.1|1.509e-2789.71PREDICTED: uncharacterized protein LOC106131594 is... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008270 zinc ion binding
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_26301contignewscf_26301:478..675 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026015-RAOSCA026015-RAOstrinia scapulalismRNAnewscf_26301 478..675 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026015-PA ID=OSCA026015-PA|Name=OSCA026015-RA|organism=Ostrinia scapulalis|type=polypeptide|length=66bp
TTDSADFLATRAHTAAVIPGKPAANPLQFVRVGPADLGSRAREQLRRAEL
AKRTEPKIEIQEDWQS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding