OSCA026016-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026016-RA
Unique NameOSCA026016-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length68
Homology
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 98.2117 bits (243), Expect = 5.807e-23
Identity = 48/60 (80.00%), Postives = 53/60 (88.33%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GRKVLEW+PRA RRS+GRPPTRWTDDLV VAG TW  AA++RSLWK+L EAFVQQWT FG
Sbjct:  304 GRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 363          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 98.5969 bits (244), Expect = 1.103e-22
Identity = 48/60 (80.00%), Postives = 53/60 (88.33%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GRKVLEW+PRA RRS+GRPPTRWTDDLV VAG TW  AA++RSLWK+L EAFVQQWT FG
Sbjct:  419 GRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 478          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 98.5969 bits (244), Expect = 1.111e-22
Identity = 48/60 (80.00%), Postives = 53/60 (88.33%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GRKVLEW+PRA RRS+GRPPTRWTDDLV VAG TW  AA++RSLWK+L EAFVQQWT FG
Sbjct:  438 GRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTSFG 497          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 83.1889 bits (204), Expect = 1.004e-19
Identity = 41/60 (68.33%), Postives = 50/60 (83.33%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GRKVLEW+PR  RRS+GRPP RWTDDLV VAG  W  AA++RSLW+++ EA+VQQWT+ G
Sbjct:   14 GRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGVHWMLAAQDRSLWQSMGEAYVQQWTISG 73          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|930659181|gb|KPJ01280.1| (hypothetical protein RR46_01415 [Papilio xuthus])

HSP 1 Score: 85.5001 bits (210), Expect = 1.065e-18
Identity = 38/57 (66.67%), Postives = 48/57 (84.21%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWT 65
            GRKVLEW+PR  RRS+G+PP RWTDDLV VAG  W  AA++R+LW+++ EA+VQQWT
Sbjct:   36 GRKVLEWRPRTGRRSVGKPPARWTDDLVKVAGVHWMRAAQDRALWQSMGEAYVQQWT 92          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 78.9518 bits (193), Expect = 4.935e-18
Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GRKVLEW+PR  RRS+GRPP RWTDDLV VAG +W   A++RS W++L EA+VQQW   G
Sbjct:    6 GRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYVQQWASHG 65          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 85.1149 bits (209), Expect = 9.219e-18
Identity = 39/60 (65.00%), Postives = 50/60 (83.33%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GR+VLEW+PR  RRS+GRPP RWTDDLV VAG  W  AA++R+LW+++ EA+VQQWT +G
Sbjct:  711 GRRVLEWRPRIGRRSVGRPPARWTDDLVKVAGAHWMRAAQDRALWQSMGEAYVQQWTTYG 770          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 77.7962 bits (190), Expect = 1.975e-17
Identity = 38/60 (63.33%), Postives = 46/60 (76.67%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GRKVLEW+PR  RRS+GRPP RWTDDLV VAG +W   A++RS W++L EA+ QQW   G
Sbjct:   23 GRKVLEWRPRTGRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYAQQWASHG 82          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|930657786|gb|KPJ00059.1| (hypothetical protein RR46_00281, partial [Papilio xuthus])

HSP 1 Score: 76.2554 bits (186), Expect = 5.225e-17
Identity = 37/60 (61.67%), Postives = 46/60 (76.67%), Query Frame = 0
Query:   10 GRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GRKVLEW+PR +RRS+GRPP RWTDDLV VAG +W   A++RS W++L EA+  QW   G
Sbjct:    3 GRKVLEWRPRTDRRSVGRPPARWTDDLVKVAGASWMRVAQDRSSWRSLGEAYALQWASHG 62          
BLAST of OSCA026016-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 78.9518 bits (193), Expect = 5.551e-17
Identity = 39/71 (54.93%), Postives = 51/71 (71.83%), Query Frame = 0
Query:    2 GHVLAHYTGR---KVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKNRSLWKAL-EAFVQQWTLFG 68
            GH+     GR   +VLEW+PR  +RS+GRPP RWTDD+V  AG+ W  AA +R+ WK+L EA+VQQWT +G
Sbjct:   90 GHIARRTDGRWSRRVLEWRPRTGKRSVGRPPARWTDDIVKSAGKHWMRAASDRTRWKSLGEAYVQQWTSYG 160          
The following BLAST results are available for this feature:
BLAST of OSCA026016-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|5.807e-2380.00reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001215|gb|ABO45231.1|1.103e-2280.00reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|1.111e-2280.00reverse transcriptase [Ostrinia nubilalis][more]
gi|930681500|gb|KPJ21040.1|1.004e-1968.33hypothetical protein RR48_00071 [Papilio machaon][more]
gi|930659181|gb|KPJ01280.1|1.065e-1866.67hypothetical protein RR46_01415 [Papilio xuthus][more]
gi|930681186|gb|KPJ20726.1|4.935e-1865.00hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|909577882|ref|XP_013144778.1|9.219e-1865.00PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|930648975|gb|KPI91323.1|1.975e-1763.33hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|930657786|gb|KPJ00059.1|5.225e-1761.67hypothetical protein RR46_00281, partial [Papilio ... [more]
gi|825740785|ref|WP_047149388.1|5.551e-1754.93hypothetical protein, partial [Escherichia coli][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_35769contignewscf_35769:89..295 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026016-RAOSCA026016-RAOstrinia scapulalismRNAnewscf_35769 89..295 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026016-PA ID=OSCA026016-PA|Name=OSCA026016-RA|organism=Ostrinia scapulalis|type=polypeptide|length=68bp
VGHVLAHYTGRKVLEWQPRAERRSMGRPPTRWTDDLVNVAGRTWNGAAKN
RSLWKALEAFVQQWTLFG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity