OSCA026017-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026017-RA
Unique NameOSCA026017-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length149
Homology
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|357605106|gb|EHJ64465.1| (pyruvate kinase 2 [Danaus plexippus])

HSP 1 Score: 263.848 bits (673), Expect = 3.030e-83
Identity = 122/149 (81.88%), Postives = 141/149 (94.63%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            M++QIAWAVASD+DAVL+PNSQ   D+R VRDILSE+GKHILVFACID+V+GLDNIDD+L E+DGIYLDR +LSTDLPVEK+FIAQK++LAKCNE GKPCICKAVINEQIPTLCVTDIANLV+DGAD LSLELHYDSPLKKF+P++DA+
Sbjct:  247 MEDQIAWAVASDIDAVLVPNSQTIQDIRHVRDILSERGKHILVFACIDSVIGLDNIDDLLFESDGIYLDRCILSTDLPVEKVFIAQKVILAKCNEVGKPCICKAVINEQIPTLCVTDIANLVLDGADTLSLELHYDSPLKKFSPAFDAV 395          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|913315829|ref|XP_013188821.1| (PREDICTED: pyruvate kinase-like [Amyelois transitella])

HSP 1 Score: 261.151 bits (666), Expect = 2.888e-82
Identity = 123/149 (82.55%), Postives = 138/149 (92.62%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            M++QIAWAVASDVD VL+PN+Q++YD+RQ+R ILSEKGKHILVFACID+VLG DNI +IL EADGIY+DR VLS DLPVEKIFIAQKI+LAKCNE GKPC+ KAVINEQIPTLCVTDIANLV+DGADVL LELHYDSPLKK AP+YDAI
Sbjct:  246 MEQQIAWAVASDVDGVLVPNTQSAYDIRQIRSILSEKGKHILVFACIDSVLGFDNIGEILTEADGIYIDRAVLSMDLPVEKIFIAQKIVLAKCNEMGKPCLIKAVINEQIPTLCVTDIANLVLDGADVLCLELHYDSPLKKLAPTYDAI 394          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|827548701|ref|XP_012546533.1| (PREDICTED: pyruvate kinase-like [Bombyx mori])

HSP 1 Score: 255.758 bits (652), Expect = 4.258e-80
Identity = 118/149 (79.19%), Postives = 139/149 (93.29%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            +DEQ+ WA ASDVDA+L+PN Q S+D++Q++++LSEKGKHILV ACIDTVLGLDNID++L+EADGIY+DR VLSTDLPVEKIF+AQK +LAKCN  GKPC+CKAV+NEQIPTLCVTD+ANLV+DGADVLSLELHYDSPLKKFAP YDAI
Sbjct:  245 LDEQVNWATASDVDALLVPNCQGSHDIKQIKEMLSEKGKHILVLACIDTVLGLDNIDEVLEEADGIYVDRSVLSTDLPVEKIFLAQKQILAKCNAVGKPCLCKAVLNEQIPTLCVTDLANLVLDGADVLSLELHYDSPLKKFAPLYDAI 393          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|930651455|gb|KPI93798.1| (Pyruvate kinase muscle isozyme [Papilio xuthus])

HSP 1 Score: 248.054 bits (632), Expect = 1.265e-78
Identity = 116/149 (77.85%), Postives = 135/149 (90.60%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            ++EQI WAV+SD+DAVL+PN+Q+  D+R +R+ILS KG HILVFA IDTV GLDNIDDIL EADGIYLDR VLSTDLPVEKIFIAQKI+++KCN  GKPCI KAVINEQIPTLCV+DIANLV+DG DV+SLELHYDSPL+KFAP+YDA+
Sbjct:  111 LEEQIKWAVSSDIDAVLLPNAQSGNDIRHIRNILSNKGNHILVFASIDTVQGLDNIDDILTEADGIYLDRSVLSTDLPVEKIFIAQKIIISKCNNLGKPCISKAVINEQIPTLCVSDIANLVLDGVDVVSLELHYDSPLRKFAPAYDAV 259          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|943950653|ref|XP_014358292.1| (PREDICTED: pyruvate kinase-like [Papilio machaon] >gi|930674783|gb|KPJ15114.1| Pyruvate kinase [Papilio machaon])

HSP 1 Score: 249.595 bits (636), Expect = 8.070e-78
Identity = 117/149 (78.52%), Postives = 135/149 (90.60%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            ++EQI WAV+SD+DAVL+PN+Q+  D+R +R+ILS KG HILVFA IDTV GLDNIDDIL EADGIYLDR VLSTDLPVEKIFIAQKI++AKCN  GKPCI KAVINEQIPTLCV+DIANLV+DG DV+SLELHYDSPL+KFAP+YDA+
Sbjct:  243 LEEQIKWAVSSDIDAVLLPNAQSGNDIRHIRNILSNKGNHILVFASIDTVQGLDNIDDILTEADGIYLDRSVLSTDLPVEKIFIAQKIIMAKCNNLGKPCISKAVINEQIPTLCVSDIANLVLDGVDVISLELHYDSPLRKFAPAYDAV 391          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|910354068|ref|XP_013181081.1| (PREDICTED: pyruvate kinase-like [Papilio xuthus])

HSP 1 Score: 247.284 bits (630), Expect = 1.589e-76
Identity = 116/149 (77.85%), Postives = 135/149 (90.60%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            ++EQI WAV+SD+DAVL+PN+Q+  D+R +R+ILS KG HILVFA IDTV GLDNIDDIL EADGIYLDR VLSTDLPVEKIFIAQKI+++KCN  GKPCI KAVINEQIPTLCV+DIANLV+DG DV+SLELHYDSPL+KFAP+YDA+
Sbjct:  279 LEEQIKWAVSSDIDAVLLPNAQSGNDIRHIRNILSNKGNHILVFASIDTVQGLDNIDDILTEADGIYLDRSVLSTDLPVEKIFIAQKIIISKCNNLGKPCISKAVINEQIPTLCVSDIANLVLDGVDVVSLELHYDSPLRKFAPAYDAV 427          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|768427157|ref|XP_011554653.1| (PREDICTED: pyruvate kinase-like [Plutella xylostella])

HSP 1 Score: 242.276 bits (617), Expect = 6.443e-75
Identity = 111/147 (75.51%), Postives = 136/147 (92.52%), Query Frame = 0
Query:    3 EQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            +QIAWAVASDVDA+LIPN+Q+  DV+QVRDIL++KGKHILVF+ I+T+ G+DNID+I+ E+DGIYLDR +LSTDLP+EKIFIAQKI+++KC EAGKPCICKA++NEQIPTLCV+DIANLVIDG DV+ LELHYDSPLKK +PSYD +
Sbjct:  248 DQIAWAVASDVDALLIPNTQHESDVKQVRDILADKGKHILVFSSIETMYGVDNIDEIIAESDGIYLDRSILSTDLPIEKIFIAQKIIVSKCKEAGKPCICKAILNEQIPTLCVSDIANLVIDGVDVICLELHYDSPLKKLSPSYDTV 394          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|914564453|gb|KOB69891.1| (Pyruvate kinase [Operophtera brumata])

HSP 1 Score: 235.343 bits (599), Expect = 3.296e-72
Identity = 104/149 (69.80%), Postives = 137/149 (91.95%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            M++QIAWAV +D+DAVL+P++Q+++D++ V+DIL EKGKH+LVFAC+DTVL ++NID+I+ E+DG+YLDR +L+ D+PVEKIFIAQK +LAKCNEAGKPCI KAV+NEQIPTLCVTDIANL++DGADV+SLELHYDSPL++ A + DA+
Sbjct:  245 MEQQIAWAVGADIDAVLVPDAQSAHDIKHVKDILDEKGKHMLVFACLDTVLSMENIDEIITESDGVYLDRCILAMDIPVEKIFIAQKTILAKCNEAGKPCIVKAVLNEQIPTLCVTDIANLILDGADVISLELHYDSPLRRIAATQDAM 393          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|909557656|ref|XP_013133805.1| (PREDICTED: pyruvate kinase-like isoform X1 [Papilio polytes])

HSP 1 Score: 193.741 bits (491), Expect = 1.966e-56
Identity = 95/149 (63.76%), Postives = 114/149 (76.51%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            ++EQI WAV+SD+DAVL+PN+Q+  D+R +R+ILS KG HILVFA IDTV GLDNIDDIL EADGIYLDR +LSTDLPVEKIFIAQKI++AKCN                         NLV+DGADV++LELHYDSPL+KFAP+YDA+
Sbjct:  243 LEEQIKWAVSSDIDAVLLPNTQSGNDIRHIRNILSNKGNHILVFASIDTVQGLDNIDDILTEADGIYLDRSILSTDLPVEKIFIAQKIIMAKCN-------------------------NLVLDGADVIALELHYDSPLRKFAPAYDAV 366          
BLAST of OSCA026017-RA vs. genbank:protein
Match: gi|909557658|ref|XP_013133806.1| (PREDICTED: pyruvate kinase-like isoform X2 [Papilio polytes])

HSP 1 Score: 187.578 bits (475), Expect = 4.135e-54
Identity = 92/149 (61.74%), Postives = 111/149 (74.50%), Query Frame = 0
Query:    1 MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTVLGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPCICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI 149
            ++EQI WAV+SD+DAVL+PN+Q+  D+R +R+ILS KG HILVFA IDTV GLDNIDDIL EADGIYLDR +LSTDLPVEKIFIAQKI++AKCN                            +DGADV++LELHYDSPL+KFAP+YDA+
Sbjct:  243 LEEQIKWAVSSDIDAVLLPNTQSGNDIRHIRNILSNKGNHILVFASIDTVQGLDNIDDILTEADGIYLDRSILSTDLPVEKIFIAQKIIMAKCNN---------------------------LDGADVIALELHYDSPLRKFAPAYDAV 364          
The following BLAST results are available for this feature:
BLAST of OSCA026017-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357605106|gb|EHJ64465.1|3.030e-8381.88pyruvate kinase 2 [Danaus plexippus][more]
gi|913315829|ref|XP_013188821.1|2.888e-8282.55PREDICTED: pyruvate kinase-like [Amyelois transite... [more]
gi|827548701|ref|XP_012546533.1|4.258e-8079.19PREDICTED: pyruvate kinase-like [Bombyx mori][more]
gi|930651455|gb|KPI93798.1|1.265e-7877.85Pyruvate kinase muscle isozyme [Papilio xuthus][more]
gi|943950653|ref|XP_014358292.1|8.070e-7878.52PREDICTED: pyruvate kinase-like [Papilio machaon] ... [more]
gi|910354068|ref|XP_013181081.1|1.589e-7677.85PREDICTED: pyruvate kinase-like [Papilio xuthus][more]
gi|768427157|ref|XP_011554653.1|6.443e-7575.51PREDICTED: pyruvate kinase-like [Plutella xylostel... [more]
gi|914564453|gb|KOB69891.1|3.296e-7269.80Pyruvate kinase [Operophtera brumata][more]
gi|909557656|ref|XP_013133805.1|1.966e-5663.76PREDICTED: pyruvate kinase-like isoform X1 [Papili... [more]
gi|909557658|ref|XP_013133806.1|4.135e-5461.74PREDICTED: pyruvate kinase-like isoform X2 [Papili... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006096 glycolytic process
molecular_function GO:0003824 catalytic activity
molecular_function GO:0016301 kinase activity
molecular_function GO:0000287 magnesium ion binding
molecular_function GO:0030955 potassium ion binding
molecular_function GO:0004743 pyruvate kinase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001697Pyruvate kinasePRINTSPR01050PYRUVTKNASEcoord: 13..27
score: 25.64
coord: 43..69
score: 32.19
coord: 70..94
score: 43.02
IPR001697Pyruvate kinasePANTHERPTHR11817PYRUVATE KINASEcoord: 5..127
IPR015793Pyruvate kinase, barrelPFAMPF00224PKcoord: 3..131
e-value: 2.1E-28
score: 98.8
IPR015813Pyruvate/Phosphoenolpyruvate kinase-like domainGENE3D3.20.20.60coord: 3..131
e-value: 1.6E-30
score: 105.7
IPR015813Pyruvate/Phosphoenolpyruvate kinase-like domainSUPERFAMILY51621Phosphoenolpyruvate/pyruvate domaincoord: 3..131
NoneNo IPR availablePANTHERPTHR11817:SF3PYRUVATE KINASEcoord: 5..127

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_34408contignewscf_34408:444..890 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026017-RAOSCA026017-RAOstrinia scapulalismRNAnewscf_34408 444..890 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026017-PA ID=OSCA026017-PA|Name=OSCA026017-RA|organism=Ostrinia scapulalis|type=polypeptide|length=149bp
MDEQIAWAVASDVDAVLIPNSQNSYDVRQVRDILSEKGKHILVFACIDTV
LGLDNIDDILKEADGIYLDRGVLSTDLPVEKIFIAQKILLAKCNEAGKPC
ICKAVINEQIPTLCVTDIANLVIDGADVLSLELHYDSPLKKFAPSYDAI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016301kinase activity
GO:0003824catalytic activity
GO:0030955potassium ion binding
GO:0000287magnesium ion binding
GO:0004743pyruvate kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0006096glycolytic process
Vocabulary: INTERPRO
TermDefinition
IPR015813Pyrv/PenolPyrv_Kinase-like_dom
IPR015793Pyrv_Knase_brl
IPR001697Pyr_Knase