OSCA026018-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026018-RA
Unique NameOSCA026018-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length46
Homology
The following BLAST results are available for this feature:
BLAST of OSCA026018-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 46..46
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 27..45
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..26
NoneNo IPR availableTMHMMTMhelixcoord: 21..43

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_18547contignewscf_18547:4..144 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026018-RAOSCA026018-RAOstrinia scapulalismRNAnewscf_18547 4..144 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026018-PA ID=OSCA026018-PA|Name=OSCA026018-RA|organism=Ostrinia scapulalis|type=polypeptide|length=46bp
GTSTLKVDRRHHKGSRKALDVGRYQPGNMVSIGGGLCSAVAVLWLS
back to top