OSCA026019-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026019-RA
Unique NameOSCA026019-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length81
Homology
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|827555351|ref|XP_012549159.1| (PREDICTED: fibrous sheath-interacting protein 2 [Bombyx mori])

HSP 1 Score: 141.354 bits (355), Expect = 9.162e-39
Identity = 63/76 (82.89%), Postives = 72/76 (94.74%), Query Frame = 0
Query:    4 SDVGIDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            S+  +DDLS+IDITLMTL KPT+LKKVIDS+PKPVRAVPKNGLPMW+RLGLECKLP+PK+P GKIVF+RGKIGEDV
Sbjct:    7 SETCLDDLSDIDITLMTLRKPTDLKKVIDSVPKPVRAVPKNGLPMWFRLGLECKLPVPKIPEGKIVFSRGKIGEDV 82          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|357629650|gb|EHJ78281.1| (hypothetical protein KGM_17560 [Danaus plexippus])

HSP 1 Score: 137.502 bits (345), Expect = 3.835e-36
Identity = 62/78 (79.49%), Postives = 72/78 (92.31%), Query Frame = 0
Query:    2 SASDVGIDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            SA+ V +DD+ ++D TLMTL KPTELKKVIDSIPKP+RAVPKNGLP+WYRLGLECKLP+PKMP GKI+F+RGKIGEDV
Sbjct:    4 SATSVELDDILDVDTTLMTLRKPTELKKVIDSIPKPIRAVPKNGLPLWYRLGLECKLPVPKMPAGKIIFSRGKIGEDV 81          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|930652739|gb|KPI95078.1| (Fibrous sheath-interacting protein 2 [Papilio xuthus])

HSP 1 Score: 128.257 bits (321), Expect = 2.856e-33
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 0
Query:    1 MSASDVGIDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            +  S+   D+ S ++I LM L KPTELKKVI+S+PKPV AVPKNGLPMWYRLGLE KLPMPKMP+GKI+F+RGKIGEDV
Sbjct:    4 IKTSEFAADNTSEVNIALMMLRKPTELKKVIESVPKPVSAVPKNGLPMWYRLGLESKLPMPKMPLGKIIFSRGKIGEDV 82          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|910344407|ref|XP_013176023.1| (PREDICTED: uncharacterized protein LOC106124109 [Papilio xuthus])

HSP 1 Score: 125.561 bits (314), Expect = 9.440e-32
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 0
Query:    1 MSASDVGIDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            +  S+   D+ S ++I LM L KPTELKKVI+S+PKPV AVPKNGLPMWYRLGLE KLPMPKMP+GKI+F+RGKIGEDV
Sbjct:    4 IKTSEFAADNTSEVNIALMMLRKPTELKKVIESVPKPVSAVPKNGLPMWYRLGLESKLPMPKMPLGKIIFSRGKIGEDV 82          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|914576938|gb|KOB78732.1| (Uncharacterized protein OBRU01_01329 [Operophtera brumata])

HSP 1 Score: 123.25 bits (308), Expect = 3.485e-31
Identity = 56/72 (77.78%), Postives = 65/72 (90.28%), Query Frame = 0
Query:    8 IDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            I++ +++D  LMTL KPTELKKVIDSIPKP+ AVPKNGLP WYRLGLECKLP+PKMP GKI+F+RGKIGEDV
Sbjct:    7 INEQNDVDTILMTLRKPTELKKVIDSIPKPLGAVPKNGLPNWYRLGLECKLPVPKMPEGKIIFSRGKIGEDV 78          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|943946662|ref|XP_014356501.1| (PREDICTED: uncharacterized protein LOC106709254 [Papilio machaon] >gi|930676325|gb|KPJ16484.1| Fibrous sheath-interacting protein 2 [Papilio machaon])

HSP 1 Score: 123.25 bits (308), Expect = 5.866e-31
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 0
Query:    1 MSASDVGIDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            +  S+   D+ S ++I LM L KPTELKKVI+S+PKPV AVPKNGLPMWYRLGLE KLP+PKMP+GKI+F+RGKIGEDV
Sbjct:    4 IKTSEFAADNTSEVNIALMMLRKPTELKKVIESVPKPVSAVPKNGLPMWYRLGLESKLPVPKMPLGKIIFSRGKIGEDV 82          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|909556485|ref|XP_013133172.1| (PREDICTED: uncharacterized protein LOC106099247 [Papilio polytes])

HSP 1 Score: 121.324 bits (303), Expect = 2.530e-30
Identity = 55/79 (69.62%), Postives = 67/79 (84.81%), Query Frame = 0
Query:    1 MSASDVGIDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            +  S+   D+ S ++I LM L KPT+LKKVI+S+PKPV AVPKNGLPMW+RLGLE KLPMPKMP+GK+VF+RGKIGEDV
Sbjct:    4 VKTSEFAADNSSEVNIALMMLRKPTDLKKVIESVPKPVSAVPKNGLPMWFRLGLESKLPMPKMPLGKVVFSRGKIGEDV 82          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|768411109|ref|XP_011561961.1| (PREDICTED: fibrous sheath-interacting protein 2-like [Plutella xylostella])

HSP 1 Score: 109.383 bits (272), Expect = 6.403e-28
Identity = 48/68 (70.59%), Postives = 57/68 (83.82%), Query Frame = 0
Query:   12 SNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
             +ID  L+TL KPTEL +V DS+PKP RAVPKNGLP WY+LGL+CKLP+P+ P  KIVF+RGKIGEDV
Sbjct:   14 EDIDTILLTLRKPTELHRVFDSVPKPARAVPKNGLPAWYKLGLDCKLPVPQFPKDKIVFSRGKIGEDV 81          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|1185572968|ref|XP_020718799.1| (fibrous sheath-interacting protein 2 [Bombus terrestris])

HSP 1 Score: 62.003 bits (149), Expect = 2.045e-9
Identity = 30/62 (48.39%), Postives = 40/62 (64.52%), Query Frame = 0
Query:   18 LMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            ++ L +PT L K+ DSIPKP  AVP+ GLP W  + LE K+PM   P G   F R K+GE++
Sbjct:   12 IIGLKRPTALDKLFDSIPKPKGAVPEFGLPKWKVMPLESKIPMVPGPEGVYNFTRRKLGEEL 73          
BLAST of OSCA026019-RA vs. genbank:protein
Match: gi|815919723|ref|XP_012244827.1| (PREDICTED: fibrous sheath-interacting protein 2 [Bombus impatiens])

HSP 1 Score: 60.4622 bits (145), Expect = 5.086e-9
Identity = 30/62 (48.39%), Postives = 40/62 (64.52%), Query Frame = 0
Query:   18 LMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWYRLGLECKLPMPKMPVGKIVFARGKIGEDV 79
            ++ L +PT L K+ DSIPKP  AVP+ GLP W  + LE K+PM   P G   F R K+GE++
Sbjct:   12 IIGLKRPTALDKLFDSIPKPKGAVPEFGLPKWKVMPLESKIPMVPGPEGVYNFTRRKLGEEL 73          
The following BLAST results are available for this feature:
BLAST of OSCA026019-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 10
Match NameE-valueIdentityDescription
gi|827555351|ref|XP_012549159.1|9.162e-3982.89PREDICTED: fibrous sheath-interacting protein 2 [B... [more]
gi|357629650|gb|EHJ78281.1|3.835e-3679.49hypothetical protein KGM_17560 [Danaus plexippus][more]
gi|930652739|gb|KPI95078.1|2.856e-3372.15Fibrous sheath-interacting protein 2 [Papilio xuth... [more]
gi|910344407|ref|XP_013176023.1|9.440e-3272.15PREDICTED: uncharacterized protein LOC106124109 [P... [more]
gi|914576938|gb|KOB78732.1|3.485e-3177.78Uncharacterized protein OBRU01_01329 [Operophtera ... [more]
gi|943946662|ref|XP_014356501.1|5.866e-3170.89PREDICTED: uncharacterized protein LOC106709254 [P... [more]
gi|909556485|ref|XP_013133172.1|2.530e-3069.62PREDICTED: uncharacterized protein LOC106099247 [P... [more]
gi|768411109|ref|XP_011561961.1|6.403e-2870.59PREDICTED: fibrous sheath-interacting protein 2-li... [more]
gi|1185572968|ref|XP_020718799.1|2.045e-948.39fibrous sheath-interacting protein 2 [Bombus terre... [more]
gi|815919723|ref|XP_012244827.1|5.086e-948.39PREDICTED: fibrous sheath-interacting protein 2 [B... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19041contignewscf_19041:4902..5147 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026019-RAOSCA026019-RAOstrinia scapulalismRNAnewscf_19041 4902..5147 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026019-PA ID=OSCA026019-PA|Name=OSCA026019-RA|organism=Ostrinia scapulalis|type=polypeptide|length=81bp
MSASDVGIDDLSNIDITLMTLXKPTELKKVIDSIPKPVRAVPKNGLPMWY
RLGLECKLPMPKMPVGKIVFARGKIGEDVSE
back to top