OSCA026020-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026020-RA
Unique NameOSCA026020-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length74
Homology
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|509162873|gb|JAA79557.1| (endonuclease-reverse transcriptase, partial [Pararge aegeria])

HSP 1 Score: 130.568 bits (327), Expect = 2.401e-38
Identity = 60/65 (92.31%), Postives = 64/65 (98.46%), Query Frame = 0
Query:    9 QGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            QGTTPEAW+RS++V FFKKGDNTLLKNYRPISLLSH+YKLFSRVITNRLARRFDDFQPPEQAGFR
Sbjct:    1 QGTTPEAWHRSVVVLFFKKGDNTLLKNYRPISLLSHIYKLFSRVITNRLARRFDDFQPPEQAGFR 65          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|838097688|gb|KLV34200.1| (hypothetical protein AB894_15325, partial [Piscirickettsia salmonis])

HSP 1 Score: 135.576 bits (340), Expect = 1.919e-35
Identity = 62/73 (84.93%), Postives = 67/73 (91.78%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            +LFNSV+L+GTTP AW RS++V FFKKGDN LLKNYRPISLLSHVYKLFSRVITNRL RR DDFQPPEQAGFR
Sbjct:  366 KLFNSVILEGTTPVAWQRSVVVLFFKKGDNCLLKNYRPISLLSHVYKLFSRVITNRLERRLDDFQPPEQAGFR 438          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|357630251|gb|EHJ78505.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 129.028 bits (323), Expect = 2.370e-35
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            +LFNSVL +G TPEAW+R ++V FFKKGD +LLKNYRPISLL H+YKLFS+VITNRLARR D+FQPPEQAGFR
Sbjct:   76 KLFNSVLFEGRTPEAWSRGVIVLFFKKGDKSLLKNYRPISLLRHIYKLFSKVITNRLARRLDEFQPPEQAGFR 148          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 132.494 bits (332), Expect = 5.898e-35
Identity = 60/73 (82.19%), Postives = 66/73 (90.41%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            +LFNSV+L+G TP  W+RS++V FFKKGD TLLKNYRPISLLSHVYKLFSRVI NRLARR DDFQPPEQAGFR
Sbjct:   22 KLFNSVILEGKTPTTWHRSVVVLFFKKGDKTLLKNYRPISLLSHVYKLFSRVIANRLARRLDDFQPPEQAGFR 94          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|357610863|gb|EHJ67180.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 132.109 bits (331), Expect = 7.539e-35
Identity = 59/73 (80.82%), Postives = 67/73 (91.78%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            +LFNSVL +G TPEAW+R +++ FFKKGD +LLKNYRPISLLSHVYKLFSRVITNRLARR D+FQPPEQAGFR
Sbjct:   86 KLFNSVLFEGKTPEAWSRGVVILFFKKGDKSLLKNYRPISLLSHVYKLFSRVITNRLARRLDEFQPPEQAGFR 158          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|827540150|ref|XP_012553149.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101739909, partial [Bombyx mori])

HSP 1 Score: 130.183 bits (326), Expect = 8.746e-35
Identity = 60/73 (82.19%), Postives = 65/73 (89.04%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            +LFNS LL+G TPEAWNR ++V FFKKGD TLLKNYRPI+LLSHVYKLFSRVITNRL RR DDFQP EQAGFR
Sbjct:   97 KLFNSSLLKGKTPEAWNRGVVVLFFKKGDKTLLKNYRPITLLSHVYKLFSRVITNRLERRLDDFQPTEQAGFR 169          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 132.109 bits (331), Expect = 9.510e-35
Identity = 60/73 (82.19%), Postives = 66/73 (90.41%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            +LFNSV+L+G TP  W+RS++V FFKKGD TLLKNYRPISLLSHVYKLFSRVI NRLARR DDFQPPEQAGFR
Sbjct:   41 KLFNSVILEGKTPTTWHRSVVVLFFKKGDKTLLKNYRPISLLSHVYKLFSRVIANRLARRLDDFQPPEQAGFR 113          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|357601939|gb|EHJ63200.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 133.65 bits (335), Expect = 1.098e-34
Identity = 60/73 (82.19%), Postives = 68/73 (93.15%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            +LFNSVL +G TPEAW+RS+++ FFKKGD +LLKNYRPISLLSHVYKLFSRVITNRLARR D+FQPPEQAGFR
Sbjct:  391 KLFNSVLFEGRTPEAWSRSVVILFFKKGDKSLLKNYRPISLLSHVYKLFSRVITNRLARRLDEFQPPEQAGFR 463          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|825740729|ref|WP_047149332.1| (hypothetical protein [Escherichia coli])

HSP 1 Score: 131.339 bits (329), Expect = 4.243e-34
Identity = 60/73 (82.19%), Postives = 66/73 (90.41%), Query Frame = 0
Query:    1 RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            RLFNSVL  G TPEAW+ S++V FFKKGD TLLKNYRPISLLSHVYKLFSRVITNRLA++ D+FQPPEQAGFR
Sbjct:  161 RLFNSVLHNGITPEAWSESVVVLFFKKGDKTLLKNYRPISLLSHVYKLFSRVITNRLAQKLDEFQPPEQAGFR 233          
BLAST of OSCA026020-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 131.339 bits (329), Expect = 6.027e-34
Identity = 61/72 (84.72%), Postives = 65/72 (90.28%), Query Frame = 0
Query:    2 LFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 73
            LFNSV+L G  P AW +S++V FFKKGDNT LKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR
Sbjct:  534 LFNSVILDGNVPLAWTKSVVVLFFKKGDNTRLKNYRPISLLSHVYKLFSRVITNRLARRFDDFQPPEQAGFR 605          
The following BLAST results are available for this feature:
BLAST of OSCA026020-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|509162873|gb|JAA79557.1|2.401e-3892.31endonuclease-reverse transcriptase, partial [Parar... [more]
gi|838097688|gb|KLV34200.1|1.919e-3584.93hypothetical protein AB894_15325, partial [Pisciri... [more]
gi|357630251|gb|EHJ78505.1|2.370e-3578.08endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|134001215|gb|ABO45231.1|5.898e-3582.19reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|357610863|gb|EHJ67180.1|7.539e-3580.82endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|827540150|ref|XP_012553149.1|8.746e-3582.19PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|134001323|gb|ABO45239.1|9.510e-3582.19reverse transcriptase [Ostrinia nubilalis][more]
gi|357601939|gb|EHJ63200.1|1.098e-3482.19endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|825740729|ref|WP_047149332.1|4.243e-3482.19hypothetical protein [Escherichia coli][more]
gi|298204337|gb|ADI61817.1|6.027e-3484.72endonuclease-reverse transcriptase [Bombyx mori][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000477Reverse transcriptase domainPFAMPF00078RVT_1coord: 28..73
e-value: 1.0E-5
score: 24.8
NoneNo IPR availablePANTHERPTHR19446REVERSE TRANSCRIPTASEScoord: 1..73

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_16540contignewscf_16540:639..863 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026020-RAOSCA026020-RAOstrinia scapulalismRNAnewscf_16540 639..863 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026020-PA ID=OSCA026020-PA|Name=OSCA026020-RA|organism=Ostrinia scapulalis|type=polypeptide|length=74bp
RLFNSVLLQGTTPEAWNRSMMVFFFKKGDNTLLKNYRPISLLSHVYKLFS
RVITNRLARRFDDFQPPEQAGFRI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity
Vocabulary: INTERPRO
TermDefinition
IPR000477RT_dom