OSCA026021-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026021-RA
Unique NameOSCA026021-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length90
Homology
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 96.6709 bits (239), Expect = 6.401e-22
Identity = 46/49 (93.88%), Postives = 47/49 (95.92%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRE 67
            LKSKVFDQCVL VMVYGSETWSLTMGLIRRLK TQRAMERAMLGVSLR+
Sbjct:  216 LKSKVFDQCVLPVMVYGSETWSLTMGLIRRLKVTQRAMERAMLGVSLRD 264          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 96.2857 bits (238), Expect = 1.909e-21
Identity = 46/49 (93.88%), Postives = 47/49 (95.92%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRE 67
            LKSKVFDQCVL VMVYGSETWSLTMGLIRRLK TQRAMERAMLGVSLR+
Sbjct:  331 LKSKVFDQCVLPVMVYGSETWSLTMGLIRRLKVTQRAMERAMLGVSLRD 379          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 96.2857 bits (238), Expect = 2.302e-21
Identity = 46/49 (93.88%), Postives = 47/49 (95.92%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRE 67
            LKSKVFDQCVL VMVYGSETWSLTMGLIRRLK TQRAMERAMLGVSLR+
Sbjct:  350 LKSKVFDQCVLPVMVYGSETWSLTMGLIRRLKVTQRAMERAMLGVSLRD 398          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 92.0485 bits (227), Expect = 6.939e-20
Identity = 43/53 (81.13%), Postives = 47/53 (88.68%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRENKHN 71
            LK+KVFDQCVL VM YG+ETWSLTMGL+RRLK TQRAMERAMLGVSLR+   N
Sbjct:  842 LKTKVFDQCVLPVMTYGTETWSLTMGLMRRLKVTQRAMERAMLGVSLRDQIRN 894          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 86.2705 bits (212), Expect = 8.070e-18
Identity = 41/53 (77.36%), Postives = 44/53 (83.02%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRENKHN 71
            LK+KVFDQCVL VM YG+ETW LT G IRRLK TQRAMERAMLGVSLR+   N
Sbjct:  623 LKTKVFDQCVLPVMTYGTETWPLTAGNIRRLKVTQRAMERAMLGVSLRDRVRN 675          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 77.411 bits (189), Expect = 1.123e-15
Identity = 36/61 (59.02%), Postives = 44/61 (72.13%), Query Frame = 0
Query:   11 SHVRNTAVLKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRENKHN 71
            S  +    LK+KVF+QCVL VM YGSE W  T GL++RL+  QRAMERAM+GVSLR+   N
Sbjct:   38 SSSKRPQCLKTKVFNQCVLPVMSYGSEMWCFTKGLMKRLRVAQRAMERAMIGVSLRDRIRN 98          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|825740729|ref|WP_047149332.1| (hypothetical protein [Escherichia coli])

HSP 1 Score: 80.1073 bits (196), Expect = 1.220e-15
Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 0
Query:   12 HVRNTAV---LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRENKHN 71
            H+ ++A+   LK+KVF+QCVL VM YG+ETW+LT+GL+ R K  QRAMERAMLGVSL +   N
Sbjct:  460 HIFSSAIPQSLKTKVFNQCVLPVMTYGAETWTLTVGLVHRFKVAQRAMERAMLGVSLMDRIRN 522          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|357608708|gb|EHJ66107.1| (reverse transcriptase [Danaus plexippus])

HSP 1 Score: 78.9518 bits (193), Expect = 1.470e-15
Identity = 36/53 (67.92%), Postives = 41/53 (77.36%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRENKHN 71
            +K+KVFDQCVL VM YGSETW  T GL+ RL+  QRAMER MLGVSLR+   N
Sbjct:  231 IKTKVFDQCVLPVMTYGSETWCFTKGLMNRLRVAQRAMERFMLGVSLRDRIRN 283          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|825740785|ref|WP_047149388.1| (hypothetical protein, partial [Escherichia coli])

HSP 1 Score: 75.485 bits (184), Expect = 2.371e-15
Identity = 37/51 (72.55%), Postives = 43/51 (84.31%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAME--RAMLGVSLRE 67
            LK+KVF+QCVL VM YG+ETWSLT+GL+ RL  TQRAME  RAM GVSLR+
Sbjct:   11 LKTKVFEQCVLPVMTYGAETWSLTLGLLNRLGVTQRAMEMKRAMPGVSLRD 61          
BLAST of OSCA026021-RA vs. genbank:protein
Match: gi|838097688|gb|KLV34200.1| (hypothetical protein AB894_15325, partial [Piscirickettsia salmonis])

HSP 1 Score: 79.337 bits (194), Expect = 2.546e-15
Identity = 35/54 (64.81%), Postives = 45/54 (83.33%), Query Frame = 0
Query:   19 LKSKVFDQCVLHVMVYGSETWSLTMGLIRRLKATQRAMERAMLGVSLRENKHNL 72
            LK+++++QCVL VM YG+ETWSLT GL+ RL+  QRAMERAMLGVSLR+   N+
Sbjct:  675 LKTRMYNQCVLPVMTYGTETWSLTAGLLERLRVAQRAMERAMLGVSLRDKIRNM 728          
The following BLAST results are available for this feature:
BLAST of OSCA026021-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|6.401e-2293.88reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001215|gb|ABO45231.1|1.909e-2193.88reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|2.302e-2193.88reverse transcriptase [Ostrinia nubilalis][more]
gi|298204337|gb|ADI61817.1|6.939e-2081.13endonuclease-reverse transcriptase [Bombyx mori][more]
gi|909577882|ref|XP_013144778.1|8.070e-1877.36PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|357603461|gb|EHJ63790.1|1.123e-1559.02endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|825740729|ref|WP_047149332.1|1.220e-1560.32hypothetical protein [Escherichia coli][more]
gi|357608708|gb|EHJ66107.1|1.470e-1567.92reverse transcriptase [Danaus plexippus][more]
gi|825740785|ref|WP_047149388.1|2.371e-1572.55hypothetical protein, partial [Escherichia coli][more]
gi|838097688|gb|KLV34200.1|2.546e-1564.81hypothetical protein AB894_15325, partial [Pisciri... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR25952FAMILY NOT NAMEDcoord: 19..71
NoneNo IPR availablePANTHERPTHR25952:SF187SUBFAMILY NOT NAMEDcoord: 19..71

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_11060contignewscf_11060:5647..5919 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026021-RAOSCA026021-RAOstrinia scapulalismRNAnewscf_11060 5647..5919 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026021-PA ID=OSCA026021-PA|Name=OSCA026021-RA|organism=Ostrinia scapulalis|type=polypeptide|length=90bp
MGSVREASRNSHVRNTAVLKSKVFDQCVLHVMVYGSETWSLTMGLIRRLK
ATQRAMERAMLGVSLRENKHNLYQLAAARDFVRVDPVLPT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity