OSCA026022-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026022-RA
Unique NameOSCA026022-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length161
Homology
BLAST of OSCA026022-RA vs. genbank:protein
Match: gi|913321489|ref|XP_013191907.1| (PREDICTED: forkhead box protein L1 [Amyelois transitella])

HSP 1 Score: 168.703 bits (426), Expect = 8.420e-49
Identity = 101/116 (87.07%), Postives = 104/116 (89.66%), Query Frame = 0
Query:    1 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVASLLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEERPGEEEARAPLAPAAQYPLLGGWRPALEPA 116
            MGLAVDDDGEDSPSPPPQSPPPT +PLPFWG GRLPGG QARKRQFDVASLLAPDDAPEK  +RRDSSGEEE EEDIDVVASD EER GEEE R  LAPAAQYPLLGGW PAL+PA
Sbjct:  176 MGLAVDDDGEDSPSPPPQSPPPTTMPLPFWGTGRLPGGCQARKRQFDVASLLAPDDAPEK--RRRDSSGEEEHEEDIDVVASDQEERVGEEETRV-LAPAAQYPLLGGWWPALDPA 288          
BLAST of OSCA026022-RA vs. genbank:protein
Match: gi|512920847|ref|XP_004929735.1| (PREDICTED: forkhead box protein C1 [Bombyx mori])

HSP 1 Score: 157.532 bits (397), Expect = 1.687e-44
Identity = 95/116 (81.90%), Postives = 98/116 (84.48%), Query Frame = 0
Query:    1 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVASLLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEERPGEEEARAPLAPAAQYPLLGGWRPALEPA 116
            MGLAVDDDGEDSPSPPPQSPPPTALPLPFW   RL GG Q RKRQFDVASLLAPD+ PEK RQRRDSS +EEPEEDIDVVASD EER  +EE R PL  A QYPLLGGW PALEPA
Sbjct:  176 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWNAARLAGGGQPRKRQFDVASLLAPDETPEK-RQRRDSSCDEEPEEDIDVVASDQEERGVDEETRGPLTTATQYPLLGGWWPALEPA 290          
BLAST of OSCA026022-RA vs. genbank:protein
Match: gi|509181233|gb|JAA88737.1| (forkhead domain 102C [Pararge aegeria])

HSP 1 Score: 138.658 bits (348), Expect = 9.566e-38
Identity = 99/117 (84.62%), Postives = 101/117 (86.32%), Query Frame = 0
Query:    1 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVASLLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEE-RPGEEEARAPLAPAAQYPLLGGWRPALEPA 116
            MGLAVDDDGEDSPSPPPQSPPPT L LPFWGGGRLP G Q RKRQFDVASLLAPD+ PEK R RRDSSGEEE EEDIDVVASD EE RP EEE R PLAPAA YPLLGGW PAL+PA
Sbjct:  115 MGLAVDDDGEDSPSPPPQSPPPTTLALPFWGGGRLPTGVQTRKRQFDVASLLAPDEGPEK-RVRRDSSGEEEVEEDIDVVASDQEEVRPVEEETRPPLAPAAHYPLLGGWWPALDPA 230          
BLAST of OSCA026022-RA vs. genbank:protein
Match: gi|357608636|gb|EHJ66075.1| (hypothetical protein KGM_06490 [Danaus plexippus])

HSP 1 Score: 128.257 bits (321), Expect = 3.288e-33
Identity = 94/116 (81.03%), Postives = 97/116 (83.62%), Query Frame = 0
Query:    1 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVASLLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEERPGEEEARAPLAPAAQYPLLGGWRPALEPA 116
            MGLAVDDDGEDSPSPPPQSPPPTALP+PFWG GRLPGG Q RKRQFDVASLLAPDDAPEK  + R  S EEE EEDIDVVASD EE   EEE R PL PAA YPLLGGW PAL+PA
Sbjct:  168 MGLAVDDDGEDSPSPPPQSPPPTALPIPFWGAGRLPGGVQPRKRQFDVASLLAPDDAPEK--RARPDSSEEEIEEDIDVVASDQEEN-REEEPRIPLTPAAHYPLLGGWWPALDPA 280          
BLAST of OSCA026022-RA vs. genbank:protein
Match: gi|910332779|ref|XP_013169755.1| (PREDICTED: forkhead box protein L1-like [Papilio xuthus] >gi|930656029|gb|KPI98356.1| Forkhead box protein B1 [Papilio xuthus])

HSP 1 Score: 109.768 bits (273), Expect = 4.664e-26
Identity = 106/136 (77.94%), Postives = 111/136 (81.62%), Query Frame = 0
Query:    1 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVASLLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEERPGEEEARAPLAPAAQYPLLGGWRPALEPA---PPPRRPAPTASARPTPR 133
            MGLAVDDDGEDSPSPPPQSPPPT LPLPFWGGGRLPGG  ARKRQFDVASLLAPD+APEK  +RRDSSGEEE EEDIDVVASD EER  EEE+RAPLAPAA YPLLG W PAL+PA      R  AP   A P P+
Sbjct:  173 MGLAVDDDGEDSPSPPPQSPPPTTLPLPFWGGGRLPGGGVARKRQFDVASLLAPDEAPEK--RRRDSSGEEEVEEDIDVVASDQEERV-EEESRAPLAPAAHYPLLGAWWPALDPALLQQLRRHAAPHTQAVPMPQ 305          
BLAST of OSCA026022-RA vs. genbank:protein
Match: gi|914575026|gb|KOB77202.1| (Uncharacterized protein OBRU01_00669 [Operophtera brumata])

HSP 1 Score: 109.383 bits (272), Expect = 6.004e-26
Identity = 90/134 (67.16%), Postives = 95/134 (70.90%), Query Frame = 0
Query:    1 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVASLLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEERPGEEEARAPLAPAAQYPLLGGWRPALEPA--PPPRRPAPTASARPTP 132
            MGLAVDDDGEDS SPPPQSPPPT LPLP+W  GRLP   QARKRQFDVASLLAPDDAP K RQR  S   EEPEEDIDVVASD E    E  +  P AP   YPLLGGW PAL+P+     RR     SA P+P
Sbjct:  176 MGLAVDDDGEDSSSPPPQSPPPTTLPLPYWSAGRLP---QARKRQFDVASLLAPDDAPVK-RQRESS---EEPEEDIDVVASDQEGTTEEGSSPPPQAP-THYPLLGGWWPALDPSLLHQLRRHTAHTSAPPSP 301          
BLAST of OSCA026022-RA vs. genbank:protein
Match: gi|943946364|ref|XP_014356354.1| (PREDICTED: forkhead box protein L1 [Papilio machaon] >gi|930676358|gb|KPJ16502.1| Forkhead box protein I2-A [Papilio machaon])

HSP 1 Score: 107.457 bits (267), Expect = 3.586e-25
Identity = 99/116 (85.34%), Postives = 103/116 (88.79%), Query Frame = 0
Query:    1 MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVASLLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEERPGEEEARAPLAPAAQYPLLGGWRPALEPA 116
            MGLAVDDDGEDSPSPPPQSPPPT LPLPFWGGGRLPGG  ARKRQFDVASLLAPD+APEK  +RRDSSGEEE EEDIDVVASD EER  EEE+RAPL PAAQYPLLG W P L+PA
Sbjct:  173 MGLAVDDDGEDSPSPPPQSPPPTTLPLPFWGGGRLPGGGVARKRQFDVASLLAPDEAPEK--RRRDSSGEEEVEEDIDVVASDQEERV-EEESRAPLTPAAQYPLLGAWWPTLDPA 285          
The following BLAST results are available for this feature:
BLAST of OSCA026022-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 7
Match NameE-valueIdentityDescription
gi|913321489|ref|XP_013191907.1|8.420e-4987.07PREDICTED: forkhead box protein L1 [Amyelois trans... [more]
gi|512920847|ref|XP_004929735.1|1.687e-4481.90PREDICTED: forkhead box protein C1 [Bombyx mori][more]
gi|509181233|gb|JAA88737.1|9.566e-3884.62forkhead domain 102C [Pararge aegeria][more]
gi|357608636|gb|EHJ66075.1|3.288e-3381.03hypothetical protein KGM_06490 [Danaus plexippus][more]
gi|910332779|ref|XP_013169755.1|4.664e-2677.94PREDICTED: forkhead box protein L1-like [Papilio x... [more]
gi|914575026|gb|KOB77202.1|6.004e-2667.16Uncharacterized protein OBRU01_00669 [Operophtera ... [more]
gi|943946364|ref|XP_014356354.1|3.586e-2585.34PREDICTED: forkhead box protein L1 [Papilio machao... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0043565 sequence-specific DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_9711contignewscf_9711:7634..8119 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026022-RAOSCA026022-RAOstrinia scapulalismRNAnewscf_9711 7634..8119 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026022-PA ID=OSCA026022-PA|Name=OSCA026022-RA|organism=Ostrinia scapulalis|type=polypeptide|length=161bp
MGLAVDDDGEDSPSPPPQSPPPTALPLPFWGGGRLPGGAQARKRQFDVAS
LLAPDDAPEKQRQRRDSSGEEEPEEDIDVVASDAEERPGEEEARAPLAPA
AQYPLLGGWRPALEPAPPPRRPAPTASARPTPRLTPGSAEMYIAPVNDLS
MLDKISLDDFN
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated