HiSeq13539 (mRNA) Thaumetopoea pityocampa

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq13539
Unique NameHiSeq13539
TypemRNA
OrganismThaumetopoea pityocampa (Pine processionary)
Sequence length2193
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly (v1.0) of Thaumetopoea pityocampa2016-11-28
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq13539HiSeq13539_pThaumetopoea pityocampapolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq13539 ID=HiSeq13539|Name=HiSeq13539|organism=Thaumetopoea pityocampa|type=mRNA|length=2193bp
GAGTACCTTTATGTGAGTCTGTGAATATCGAAATCAAAAAATTCACACGA
CACGGATTTTTATAATGTTTAGCGATTGTCTAAAACGATATTGTATTTAA
ATAAAATTCTATAATGACTGAAGATCAAGATGCAAAAGACACACAGTTGG
ATTCGGGGAGTAAGACATTCATCAACAAGAACAAAGACAAGAAAACCAAG
TCCCAAAGGCCTTTAACTAAAATTATACTACGACGACTGCCACCAACTAT
GACCGAGGAAGCATTTTTGGAACAAGTGTCACCTATACCTGAACATGACC
ATTTCTATTTTGCAAAGCCAGATCCTTCGCTGGGCAACAATGTATATTCT
CGAGCTTACATAAACTTCGTCAATGTTGATGATATATACTTATTTAGAGA
TAAGTTTGATGGATATGTTTTCCTTGATGAAAAAGGTGTAGAGTATGTTG
GCATTGTGGAATATGCGCCATTTCAAAGAATACCTAAAAAGAAAAAGAAG
AAGGATCCTAAATGTGGTACCATAGAGAGTGACCCTATTTATCAAGAGTT
TGTGGAGAATCTCAATAAGGAGCCTGAAACTGAGAATCAACCTAAGCTGG
AATATTCATATCCTGTGAATGATGGTAATGACAAGAAGGTGCAATCAACA
CCTTTGCTGGAATATCTGGCTGCTAGAAAGTTAGACAAGAGGGGAAGGGA
TGAGCGACGTAGAAGAGAAAATGACAAGAGGAAAATGAGGATTGAAAGGA
AAACCAAAGATGCACCTATAAAGAAACCTGATGATATATCAGAAGATGAG
AACTTTAATGACAATTCTGATTACTATGACAGCAAACATAATCATAACAG
CTTTTGGTATGGTGAACAGAGGATCTACCATAAGAGTAAAGGGAAAGGTG
GTACTGTTAAAACAGAGTTCAAAAGCAGTCCTTGTTCAGATGAGTTCGCA
AATACCGATTCTGATTGGGACAGTCATTTCCCTGCTCTGTCGACCAAAAC
TCATAATACTTTTACATTGACTTTTCCTAAGTATTGTGATAAGAAGGAAA
TACCAGAAGGGGGCCAGAAGAGTGGCGGTGATACATGTTTCAAGGAAGAG
GATACTGGGGATGGTGAAGTTAAGAAGATTAAATCTAGAGAATGGGAGAA
AGAAAAAAGTACCGAATCAAAAGATGACCAAGCCAAATTGGAAAGTAAAG
ATGGATCTATTTTTGAATCTAAATTTTATAGAGAGCCACGAAAATTTGGA
AGCAATTCTATTGCTGATAAAAAGAAAAGACCTGATATAGATAAAAAAGA
AAATATATTAAAAGATGACGATCAAGGTGAAGAATCTGATAAAGGAGGTA
AGAAGGATAGACGTGATAAGTTCAAGGACACTCCACGTGAGACAAAGAGT
AAAAAGTATAGTGATACAAGAAAAGAGAGAATTAGACAAAATGAATATAA
GTACGAAAAACAAGCAGCTATGAATAAAACAGTATCATCAGATAATAAAG
CTAAATCGTTGAATCATGATGATATAAAACCGTTTACTCAACTACCACAA
GTGAAGACTGATAACCTCTCTAAACCACTAGATGATAAAAAGGTGAAACT
TGATGAAGCTAAAAATGACGAAAATATACAAGATTCAATACATGATGAAC
CGTTAAACAAAGACATGTCAATTTCAATACCAAAAGCAAGAAGAAATAGT
TTAGAGTCTGGCGAAGTGCCTGTTAAAGAGGAATCTGTTCTAAAAAGGCA
GAACTCTCTTGATGACAGAAGCAAATCTACTGACAGAGAAGGTTCTGAAG
AACGTGATAGAAACGATAGCACCGAACGTCGTGCGGAAAGAAGAATCAGG
AATAAAGATCGTCCAAGCCTCGTAATATACCAGCCTGGCATGGGCAAATT
CAGTAAACAACGTCTCGCCAAAGAGAAAGAGACTCAGCCACCAACGAAAT
GTATTAGCGATAGTGAAAAGAAAGACACCTGAAATATATGTCACAAATCC
CAACGCATGGAGAACATTCAACGTAATTACCCTGAAGCTGGCTTCCAATA
CATGTCCCGGCGGACACAGTGAGGGGAGACATCTTGGGCAAGCCAACTGA
CGGAACCGCTACTCTTGTTTACGGCTGTCTTTATTGAATTGTTTACTTTA
AATACATTATGATTGGAGACGTTTTATCATAACGAAAAAAAAA
back to top

protein sequence of HiSeq13539

>HiSeq13539_p ID=HiSeq13539_p|Name=HiSeq13539|organism=Thaumetopoea pityocampa|type=polypeptide|length=622bp
MTEDQDAKDTQLDSGSKTFINKNKDKKTKSQRPLTKIILRRLPPTMTEEA
FLEQVSPIPEHDHFYFAKPDPSLGNNVYSRAYINFVNVDDIYLFRDKFDG
YVFLDEKGVEYVGIVEYAPFQRIPKKKKKKDPKCGTIESDPIYQEFVENL
NKEPETENQPKLEYSYPVNDGNDKKVQSTPLLEYLAARKLDKRGRDERRR
RENDKRKMRIERKTKDAPIKKPDDISEDENFNDNSDYYDSKHNHNSFWYG
EQRIYHKSKGKGGTVKTEFKSSPCSDEFANTDSDWDSHFPALSTKTHNTF
TLTFPKYCDKKEIPEGGQKSGGDTCFKEEDTGDGEVKKIKSREWEKEKST
ESKDDQAKLESKDGSIFESKFYREPRKFGSNSIADKKKRPDIDKKENILK
DDDQGEESDKGGKKDRRDKFKDTPRETKSKKYSDTRKERIRQNEYKYEKQ
AAMNKTVSSDNKAKSLNHDDIKPFTQLPQVKTDNLSKPLDDKKVKLDEAK
NDENIQDSIHDEPLNKDMSISIPKARRNSLESGEVPVKEESVLKRQNSLD
DRSKSTDREGSEERDRNDSTERRAERRIRNKDRPSLVIYQPGMGKFSKQR
LAKEKETQPPTKCISDSEKKDT
back to top