g17085.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg17085.t1
Unique Nameg17085.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1295contigscaffold_1295:1..13249 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g17085g17085Venturia canescensgenescaffold_1295 1..13249 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17085.t1g17085.t1-PAVenturia canescenspolypeptidescaffold_1295 598..13249 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17085.t1-CDSg17085.t1-CDS-1Venturia canescensCDSscaffold_1295 598..811 +
g17085.t1-CDSg17085.t1-CDS-2Venturia canescensCDSscaffold_1295 3080..3451 +
g17085.t1-CDSg17085.t1-CDS-3Venturia canescensCDSscaffold_1295 3878..4110 +
g17085.t1-CDSg17085.t1-CDS-4Venturia canescensCDSscaffold_1295 4327..4533 +
g17085.t1-CDSg17085.t1-CDS-5Venturia canescensCDSscaffold_1295 4652..4865 +
g17085.t1-CDSg17085.t1-CDS-6Venturia canescensCDSscaffold_1295 4978..5123 +
g17085.t1-CDSg17085.t1-CDS-7Venturia canescensCDSscaffold_1295 5234..5405 +
g17085.t1-CDSg17085.t1-CDS-8Venturia canescensCDSscaffold_1295 5629..5879 +
g17085.t1-CDSg17085.t1-CDS-9Venturia canescensCDSscaffold_1295 7338..7456 +
g17085.t1-CDSg17085.t1-CDS-10Venturia canescensCDSscaffold_1295 10446..10651 +
g17085.t1-CDSg17085.t1-CDS-11Venturia canescensCDSscaffold_1295 12345..12444 +
g17085.t1-CDSg17085.t1-CDS-12Venturia canescensCDSscaffold_1295 12573..12647 +
g17085.t1-CDSg17085.t1-CDS-13Venturia canescensCDSscaffold_1295 12754..12956 +
g17085.t1-CDSg17085.t1-CDS-14Venturia canescensCDSscaffold_1295 13120..13249 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17085.t1-exong17085.t1-exon-1Venturia canescensexonscaffold_1295 598..811 +
g17085.t1-exong17085.t1-exon-2Venturia canescensexonscaffold_1295 3080..3451 +
g17085.t1-exong17085.t1-exon-3Venturia canescensexonscaffold_1295 3878..4110 +
g17085.t1-exong17085.t1-exon-4Venturia canescensexonscaffold_1295 4327..4533 +
g17085.t1-exong17085.t1-exon-5Venturia canescensexonscaffold_1295 4652..4865 +
g17085.t1-exong17085.t1-exon-6Venturia canescensexonscaffold_1295 4978..5123 +
g17085.t1-exong17085.t1-exon-7Venturia canescensexonscaffold_1295 5234..5405 +
g17085.t1-exong17085.t1-exon-8Venturia canescensexonscaffold_1295 5629..5879 +
g17085.t1-exong17085.t1-exon-9Venturia canescensexonscaffold_1295 7338..7456 +
g17085.t1-exong17085.t1-exon-10Venturia canescensexonscaffold_1295 10446..10651 +
g17085.t1-exong17085.t1-exon-11Venturia canescensexonscaffold_1295 12345..12444 +
g17085.t1-exong17085.t1-exon-12Venturia canescensexonscaffold_1295 12573..12647 +
g17085.t1-exong17085.t1-exon-13Venturia canescensexonscaffold_1295 12754..12956 +
g17085.t1-exong17085.t1-exon-14Venturia canescensexonscaffold_1295 13120..13249 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17085.t1-introng17085.t1-intronVenturia canescensintronscaffold_1295 12957..13119 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17085.t1-stop_codong17085.t1-stop_codonVenturia canescensstop_codonscaffold_1295 13247..13249 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g17085.t1 ID=g17085.t1|Name=g17085.t1|organism=Venturia canescens|type=mRNA|length=2642bp|location=Sequence derived from alignment at scaffold_1295:1..13249+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGCGTATCTCATTTCGGATCCACCGAGTGACCAAGTGTTCCTTGCGACG
TTTCGAGTAACAGGTGGTGACTCGTTCACCGTTGACCTCGCAGACCCCTC
GACCGAAGCGTTCAGAATACGTTCCAGGGAATATCGCGATCGCCTTAATC
TGGCCTTTCGTCGGAGCTCGTTCAAGATTTCTTTCATAACCGCCGAAGTC
CTCGCACTCGATGGTATCGAAGGTGGTGATTTGGTCGTCCATTTCGATCT
GAGGTTCGATCCGCGTTACCAGACCTTGACTGTGGAGGACGTGGCTGAAG
TTCTCCTGCGGGAAATAACCCCAGGAAAGGCGAAATATCTGGCAAGTCTG
ACGATCGATCCGAAGAGTCTCGAGGTTCAGGAAAGCATCGCAGCCCTCAA
CGCCGAATCAGCGCTGCAGACGACGGTCTCGACACCACCGACGACGACGA
CGGCACCACCTCCTAGAACTTGCAGCAGAGTGAACCTTCCTTATTGCCGA
CATTTGCCGTACAATGTCACTTCGTATCCGAACGTTCTGGGCCATAAATC
GTTGCTCGAAGTTGAGGAGGATCTCATAGCTTTTCGAGAATTAGTGGATG
CGGAGTGCTACAGATTGGCCTACGATTTCATATGCCAAGTTCTCCAACCC
GCGTGTGTACCCGGCCACGCGGAAGCTGCTCTGCATCTACCGTGTCGAAG
CTTCTGTCGAGAATTCTGGGCCGGGTGCGGCAACCGCTTGCCGGATAAAA
TCAAATCTGCAATCGACTGTTCGAACTTTCCTGAGTACGCTGATCATGGC
AGTTGCAGGCCGAAGCCAGGCTGCGTTCGAGACTTGCAGAGCAAAGCATT
GTCGCCTCGTATCTGCGACGGTGTAATCGACTGCCCTGATCTTTCGGACG
AGAAAAACTGCGCTTACTGTCAAGAGGGTTTCATGCACTGTGGTGTCGGC
CGGACGTGCATTTCTCGAGCGAAACGATGCGATGGTAAAATCGACTGTCC
CGGCGGCAGCGACGAGAAAGATTGCCTGTCCCTGGCGAAAAGTGTCAACT
CGATGAAATCTCAGCTAACGGAAACTCCGCTATCTTCGAAGTACACCCGC
GAAGGCTACGTCGTTTTCAACGAGAAAGGAACCGTTGGCAAACTGTGCAC
AGAAAATTTAAACGCCACTTTACCGGAAACGGAAATGGACAACGTTCTCC
GAAGCTCTGCCAGCTCGCTCTGCAATCTGCTGACATACACGGGCCTGGAC
ACGGTCGAAATCAAAGTCGACGAAGAAAAAGACATTCAGTACGTTCACAT
GGAGGATCCTTCAGCGTCCGAAATAACTTTCGTCAGAGCTCCTTGCCCGA
GCAAGCAAGTCATGTACGTCCGATGTGCGGACCTCGAATGCGGCCTGCAG
GCCCTGAGGAAAGGAGGAGGAACCGAAGGCCTCAGCAAAATGTCCGAACC
CGGAGACTGGCCTTGGCACGCTGCCCTCTTCAAAGAAGACGTCCACGTGT
GTGACGCGACTCTCGTCGCAGCTGAGTGGCTCCTGACGACAGCTTCGTGT
TTCCAGGGACAAGACAAAGCGGAATGGAGTGCACGTTTGGGGACGGTCAG
ATTGACGAGTACTTCGCCATGGCAACAGGAGAGAAGAATCGTGGGGATGT
TGAAGTCACCGGTGGAAGGAAGCACGATGGTTCTGCTGAAGCTGGACCGA
CCATTGTCCGCGTATTCGGATTTCGTTCGCCCAGTTTGCCTGCCATCGAG
TGACGAGCCGATGCTAGCGAATGCCACTTATTGCACGACCCTCGGATGGG
CCAGGAATCGCGATATGCTGCAAAGAGTCGAACTGAGGCAAAGCGCCATG
GAGAGATGCGAAAACATCAGCATCGCAACCGTTAATGGGATATGCACCGA
GCCTGCTTACTCTATGGACGACTGCAGCACTACTCAAAAAATCAATGGAG
TTGAAAAGATCCCGACAAACGATTGCCCAATCGTCGAGAAGACAGTGAAA
TCAGGATCGTCTGATCTTGCTCGGATCGAAATAAAAACGCAGCATCCTTT
GGACCTTTTCAAAGAGTGGCACGAGGAGGCCAAAAAATATTCGAACGGAA
TACCAAATGCGCTGTGCCTTGCCACCGTTTCCAAGGATCTCAGAGTCAGT
GCTCGCCACGTGATTCTTCGTGACTACGACGAGCGTGGTTTTGTGATCGT
AACGGACAGCCGAAGTCGAAAATCCCACGAATTGGAAGAAGTACCAAAAG
CAGCAATGTGCATTCTTTGGGCCTACCCCAACGAGAAGCATCAAAATATA
TCGAGACAGGTGAGAATTGAGGGAAATGTCGAAAAGCTGTCCCCCCCAGA
ATTCCGGTATCTCTACGACCGTGAGCCAGTCTATTGCAAAATCAGATCCT
ACCTCTGTTGTCAGGGTGAAAAAGTGGATTGGAATAATCAGAAAAACATT
CATGATAAACTGGTGCAAGACGTCCAGGACGGAAAGCAAGATTTGTCGAT
GCCAGAACATTTCATCGCGTACAGACTCTGCCCAGAAAGCATGGAATTTT
ACTTCGCCTACGATCACCTCATAGCCGATCGTCTTCTTTTCACGAAGGCA
TCTGACGACTCATCGTGGACGAATCTCAGGATCGCAGCATGA
back to top

protein sequence of g17085.t1

>g17085.t1-PA ID=g17085.t1-PA|Name=g17085.t1|organism=Venturia canescens|type=polypeptide|length=879bp
AYLISDPPSDQVFLATFRVTGGDSFTVDLADPSTEAFRIRSREYRDRLNL
AFRRSSFKISFITAEVLALDGIEGGDLVVHFDLRFDPRYQTLTVEDVAEV
LLREITPGKAKYLASLTIDPKSLEVQESIAALNAESALQTTVSTPPTTTT
APPPRTCSRVNLPYCRHLPYNVTSYPNVLGHKSLLEVEEDLIAFRELVDA
ECYRLAYDFICQVLQPACVPGHAEAALHLPCRSFCREFWAGCGNRLPDKI
KSAIDCSNFPEYADHGSCRPKPGCVRDLQSKALSPRICDGVIDCPDLSDE
KNCAYCQEGFMHCGVGRTCISRAKRCDGKIDCPGGSDEKDCLSLAKSVNS
MKSQLTETPLSSKYTREGYVVFNEKGTVGKLCTENLNATLPETEMDNVLR
SSASSLCNLLTYTGLDTVEIKVDEEKDIQYVHMEDPSASEITFVRAPCPS
KQVMYVRCADLECGLQALRKGGGTEGLSKMSEPGDWPWHAALFKEDVHVC
DATLVAAEWLLTTASCFQGQDKAEWSARLGTVRLTSTSPWQQERRIVGML
KSPVEGSTMVLLKLDRPLSAYSDFVRPVCLPSSDEPMLANATYCTTLGWA
RNRDMLQRVELRQSAMERCENISIATVNGICTEPAYSMDDCSTTQKINGV
EKIPTNDCPIVEKTVKSGSSDLARIEIKTQHPLDLFKEWHEEAKKYSNGI
PNALCLATVSKDLRVSARHVILRDYDERGFVIVTDSRSRKSHELEEVPKA
AMCILWAYPNEKHQNISRQVRIEGNVEKLSPPEFRYLYDREPVYCKIRSY
LCCQGEKVDWNNQKNIHDKLVQDVQDGKQDLSMPEHFIAYRLCPESMEFY
FAYDHLIADRLLFTKASDDSSWTNLRIAA
back to top

mRNA from alignment at scaffold_1295:1..13249+

Legend: intronpolypeptideCDSexonstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g17085.t1 ID=g17085.t1|Name=g17085.t1|organism=Venturia canescens|type=mRNA|length=13249bp|location=Sequence derived from alignment at scaffold_1295:1..13249+ (Venturia canescens)
AAATTTAACTGATTTTTTTTTACACTTCACTTTATAAGATGCAATCGGTT TAAAAGCAGTGACATCATTTTCATTCTAATACCTCAACTTCCTTAATCCG TTTCTCTACATTTCCAATCTCCTGGAAAAATCCAACGAAAAAAATGACGT TTGGGCGGTTTTTTTCGAGCAAATACCCAGACAAACCGCCTCACTTATAG TTTGCGTTCTGCACCATCAATCCTTGGACAACGCTCCAAAGTTGTGCTGG TAAATAGCAACTAATGTGCACGAGAGGTGTGGTGAAAGGTGACTCGCTAA AGAACACATGCCGCACCTGTATCATTACGTATTTTGCTATAGTTTCATCG CGCCCCTCGTTTATACACACTTTTTACACACTTATTGCAATCGTCGATTA TTACTGCGTTCAAAAAGTTCGGTGTAACACGCCATTATGTCATTTCTCAA CGATATAATTGCAGGGATTTGTACAAATAGAGGTTCGAGGAGACGAAAAA ATCTGTACGAATCTCTTGAAATTCATTGCTGTTTTGATCATCGAGAGAAG TTTATTACTGCGATCAAAATAATGGTTTTTTTCTCTTTCAATTACAGATG CGTATCTCATTTCGGATCCACCGAGTGACCAAGTGTTCCTTGCGACGTTT CGAGTAACAGGTGGTGACTCGTTCACCGTTGACCTCGCAGACCCCTCGAC CGAAGCGTTCAGAATACGTTCCAGGGAATATCGCGATCGCCTTAATCTGG CCTTTCGTCGGAGCTCGTTCAAGATTTCTTTCATAACCGCCGAAGTCCTC GCACTCGATGGGTAAGTGTCATCAGAAACATGGGAAAAAACGAGTCATTT TTAGAAAATTCGATCACTCGAAAAACTAAAAATCATGCCAGCAGTTCGCC ATGATGATCGCTCACGACGTTAAGGTAGATTTTTACTCCATAATTGAAGA TATTCTCATTCGAATTAATGTCAGAGTTATTAATTCGAAATTGCAAATAC ATTTTTTCAACTCATTTTTTGGCGAATTAAATTACTGAACCCGAAATACT GAAATAAGCAAATGTGTGGTTACGAGTGCTCATCGCCAATTTCGTTCAAT CTTTAACGCAATACATCTTTATTATACTGGTAAGACAATCGTCTCGAATT TTTTCCCAAACCTTCGTTATATCGTTATTGCGGCCTTTTTCATAAACTTC AGCGTTTATACGTCACGTGGAAAGATAAACGACTTTTTACGCATAATCCC TATATTCCTGTGTATTTTTGTTCACATTTAAACACGTTTATCTGAATAAC CAATGAGACGAACCTTTCAAAATTTGATATGCGTGTCGATCGAATACTTA TTTAAACTCTGTGTAAATTTAAAGACTTTCTTACGAAAATCGTTTCGTGC ATGATCTACCTTACTCAACTATTGTGAAACTGCATGAATTTCTGCTGACA TGAGAAGAGGTGAATGCACTTCGATTGATAAAAATGGCGAGACTGAGACC CGGACAGGCTCGATATTGGCGGAAACGCTTTACGTAACTCCTACAACCTT AATGATCCTTTTCCCGATACGTATGCTCGAGTTTCGTTGGAATCAAAGTG CACGTAGCATGAGTGCGTTAGAGCGCTAAATTAAGGACACCGTCTCATGG GAACTTTCTGAAATCCCGGAAAGTCGGTTATGTCGGCTCGGAGACTGTGA CCGTTCGTCGGGGCACTTGAGGAATTGAGTTCTCTTGATCGATCTCACGA ATCTCCGGGTCTAAAATTTCGATGATTTTGTTCGATCGTTTTTTTCCGAA TAATTAAATCTCGAAACCCGCACAAAGTGGGGCTCGGAGAAGCGTTCTGA ATCTGAGTTCTTCGACCTTGGAAGGCCAAAGAGAATTTAAAAATTCAAAT GAAACCGAAGAAAGCGAGTTTGGAGAGCTTCCAACTGGCAAAAGCTCATT CATTATTCATTTTTTTCTACAAAACCGGACCCTCCGCATTGTCCTTGAAT TCCCGTTGTCTCGAGCCAGAGCAAGTGTTAACGGATTTTCTAAGCACTCG AGAAGCCGCGATCGGTTTGTGTGTTAATGGAGAATTTCTCTCAGCGATTG AGCTTCATTTTCTCGTTGATCAGCTCACAAGTGTTTTTTTATAATCGAGT CCCCCCGTAATTAAAAGAGAAACTTTTAACCAGATGAAACTGCTTAGGAA CAAAAGTCTCTCGTGAATACTGAATGAGCTTCCGAGGAGACTCGAGCGGG TCTCTCCACCGGAAAAGCCTCGATCGGAACTGACGAATGGGCAACTCCAA GTTTGCTTCGATGGTCGAGCATGCGAAAGATAACGACACCAGGGGAAACG AGAGTGCGATGGAAATTCCTGATTGTAACGCATTCTCTATAACAACCTCG ATGCGGAATGACCTAAGAAGCCTGCGGAATATTTATATGTGAAAGTACAT GTAAACCTGCGAAGAGTATCATCGCGCGATAGGCAGAGACGAAGCTATTG ACCTAGTGAGCCAGTTCGAATGTTTACAGGAAATTCAATAATGCAAAATA AAACTACACGAGCAAACAGCCGATCGTTAGTTATCGCTGTGGCTCATTTA GATTCGAGTTTAAATCGTGATTTTTCACTGGGACGAAGTGCGTTTTGAGT TCAATTCGAAGGAACGACTTGGCCAGAGACTCGAACGTTGACTTTTGGCT CCACTTTCGATGTTATAATTTGCTGAAACATCTTTCGAAATGAAACTTTT TGGAGGAAATTCACATTTCGTTGAGCATTTTACAGAATGTGTCTGAACTG CTGTTTCGGTTCCAACTTTGTGAGTTCTTCAATTCCGAGTCCAGATTCGT AATCGTTCAATAGTTCGATGCCAAATTCATCGAGATTTTTCGAGTTAATC GTACTGAAATGAAATTAGCACGAGTGAGTTTAAAAACGTTCGGTCAAGAG CTCTAAGAATTTGTAACTGTGGATGATTTTAGTTGTCAAAAATAAATGAT TGTTCAGGGTTGTTCGGCGTGATGAAATCTTCGAATTCGTTTGCACCTCC AAAAGTCTTTAATATTTTTTCATCTGCAGTATCGAAGGTGGTGATTTGGT CGTCCATTTCGATCTGAGGTTCGATCCGCGTTACCAGACCTTGACTGTGG AGGACGTGGCTGAAGTTCTCCTGCGGGAAATAACCCCAGGAAAGGCGAAA TATCTGGCAAGTCTGACGATCGATCCGAAGAGTCTCGAGGTTCAGGAAAG CATCGCAGCCCTCAACGCCGAATCAGCGCTGCAGACGACGGTCTCGACAC CACCGACGACGACGACGGCACCACCTCCTAGAACTTGCAGCAGAGTGAAC CTTCCTTATTGCCGACATTTGCCGTACAATGTCACTTCGTATCCGAACGT TCTGGGCCATAAATCGTTGCTCGAAGTTGAGGAGGATCTCATAGCTTTTC GGTACGTTCAAATTTATCACCGCGCGTTATGAAGTTGAAAAAGGTCACAA ATCTTGAATTCACGTGAAATCGAAAAGCGTCCGAAGCTCGTTAAATTCTC AAGCGGCCAGTCCCTGCTCCCGTTTTTCCGTTGAGGCGGTAACGGATATG AAAATCTGTTGGAACTGATCGAGGAAATAAAGTTTCATGCCGATCAAACG ATCGGAATTTGCTTGCGAACATTTTATTGCATTTTATTGCACAATTTGTT TGCAAGATAATTTTTCGTTCACTTCAGTCCTTGAAACTGATATCTGGAGG ATATTTGGAAAAATTTTGAAAAACTATTGATGTTCCCAGTCCCGCGAAAT CAAAGGCATCGAGCAGGAAATAAACTACTCGATCGTCGACTCTTATTTAA TGTTTTTTTACGTTTTCTTTTGCCCAGAGAATTAGTGGATGCGGAGTGCT ACAGATTGGCCTACGATTTCATATGCCAAGTTCTCCAACCCGCGTGTGTA CCCGGCCACGCGGAAGCTGCTCTGCATCTACCGTGTCGAAGCTTCTGTCG AGAATTCTGGGCCGGGTGCGGCAACCGCTTGCCGGATAAAATCAAATCTG CAATCGACTGTTCGAACTTTCCTGAGTACGCTGATCATGGCAGTTGCAGG CCGAAGCCAGGTGACGATTTCTTCGTCATTTTCATTTCTTCGTTTGATGG ACCAAATTGAAATATCGAAAATTATTGAATCATTTGATTGTTCATTAATT TTTTTATAATTCACTGAATTTATAAATTGAAATAAATAAATAATCATTTA ATAATAGTAAAAATAATTTCAAAAAATAATAAATAATAATAAGTTAGATT TAAAATAACGAATAAAATGTTATCAGGCTGCGTTCGAGACTTGCAGAGCA AAGCATTGTCGCCTCGTATCTGCGACGGTGTAATCGACTGCCCTGATCTT TCGGACGAGAAAAACTGCGCTTACTGTCAAGAGGGTTTCATGCACTGTGG TGTCGGCCGGACGTGCATTTCTCGAGCGAAACGATGCGATGGTAAAATCG ACTGTCCCGGCGGCAGCGACGAGAAAGATTGCCGTGAGTACTTTGTCGAT TCCCACTAAGAACTGACAATCCCAGAGTGAAATGGGCGTGAGTAAAACTG GAGAAAAACCGAATGCTCCCGTGAATGAGAGATAAAAAAATTGCTGCGCA GTGTCCCTGGCGAAAAGTGTCAACTCGATGAAATCTCAGCTAACGGAAAC TCCGCTATCTTCGAAGTACACCCGCGAAGGCTACGTCGTTTTCAACGAGA AAGGAACCGTTGGCAAACTGTGCACAGAAAATTTAAACGCCACTTTACCG GAAACGGAAATGGACAACGTTCTCCGAAGCTCTGCCAGCTCGCTCTGCAA TCTGCTGACATACACGTGAGTTCATTTCGGAAAAAACAAATTTGTCCGCG TGCAAATTAAAAATTGAATACGAGAAATTTGAAATCGTTGGGAAAAAAGG AGTTTGAAAACGTTGAAAATCTTCCAGGGGCCTGGACACGGTCGAAATCA AAGTCGACGAAGAAAAAGACATTCAGTACGTTCACATGGAGGATCCTTCA GCGTCCGAAATAACTTTCGTCAGAGCTCCTTGCCCGAGCAAGCAAGTCAT GTACGTCCGATGTGCGGACCTCGGTACGTAAGAATGTTGAAAATTCAATG GAAACGATTTCAATAAAAAACATTCTGTTTCTTCCGATAACGCCCCGTCA CGATAGTAAAATTTGTTTCTAACGTCCTCGCAGAATGCGGCCTGCAGGCC CTGAGGAAAGGAGGAGGAACCGAAGGCCTCAGCAAAATGTCCGAACCCGG AGACTGGCCTTGGCACGCTGCCCTCTTCAAAGAAGACGTCCACGTGTGTG ACGCGACTCTCGTCGCAGCTGAGTGGCTCCTGACGACAGCTTCGTGTTTC CAGGGGTAAGCAGCGAATCTGAAAAACCATTGAGCCCCAAAGTGCAAGGG GAGAGCTGCTGGAGATCTCGACAAGCAGATAAGTCCTTGGGAAAGCTGGA AGAAAACGAAAAAAATAATGAGAGCCTGCTTAAATGACTTTCCATTTCGA CTCACTCCAGTGAGCTAGCAAGTCCCAAAATCTTCCAACTCTTCTAGCTT TTATTGAACAAAATGTACCTTTTCACAGACAAGACAAAGCGGAATGGAGT GCACGTTTGGGGACGGTCAGATTGACGAGTACTTCGCCATGGCAACAGGA GAGAAGAATCGTGGGGATGTTGAAGTCACCGGTGGAAGGAAGCACGATGG TTCTGCTGAAGCTGGACCGACCATTGTCCGCGTATTCGGATTTCGTTCGC CCAGTTTGCCTGCCATCGAGTGACGAGCCGATGCTAGCGAATGCCACTTA TTGCACGACCCTCGGATGGGCCAGGAATCGTAAGTGCATTGAATAATGCT CGGGGTCATTAGAAGCTCGATTTGGCATTTATTCTCAACGGAAAGCCAAT TAAAAATCCAGTCTTTTGAGACTAGAAAAGAGGAAGCGAAGTAATTCCAA GTTTCGATCGCCGGAATCAGATTTTTTTTCAAATTTAGATTTTGCTCTGA TCGATATCGAACGAAGTCGCGTCGATTTCCACGCTTTTCTCGTTTCCTCG AAGTCAAACTGTCGGCTCCTCGTGTCCATACAAATTTTTCTAACGATTTT CCAATTCCACGCATTCCAGGGACTCTAACTTATCTTCAGAATTGGAAGGA TTTTTAATGAAACTCTTCCGCCCATAAAATAGGTTCCCTCGTCACTGACA GAAACAGTAAAACGTTTTCATTTTCTCTGCTCTCTTCGTAACAGCAAACA CTGTTTTACCGACGAATACGCTGAGCTATTTCGTCCGAAACCTTCAATTG GACACATTTTTTCTTCATTTTTTTCAACAATCTCATTGAATTTCATTTAT TTTTCCTTCACTTTCGCAAACTTTAGTTACATCATTCTGGAATCTTGAAA CAACAAAAATTTCTGGTGCGATCGTACGTGATAAATGTCCTTAAATACTG CACTTGCATAGTGGAGAGTATTTTAAAAATTACCGGCGCTGATCGATGTT TACCAATTGCTGGTTGAGCTCGCGAGCGTTGTTATTACAATGCAAATTAT CGTATAAATGTATGTTTTTAAACGGTGATCACATAAGAGGTCGACACGAT CGAATGGGGTTTGAAAGCTCACAATTACTGCATTTTATCAAACTCGATAT TTCAACTGAATGAAAAAACCTTCGAGTCGCTGTTTTATTACATTTTCATC AAGTTTTTTAACATTCGGTACTTCAAGTGTACAAAAAATAATAATAAGAT GCGAAGTGTTCAGGAAATCGTTCTCAAGATCGACAATTAAACGAGGAATT AAATTATGAAGGAAAAAGTTCTCAAACGATGCACAGAAGGAAAAAACGTC CTCAAACTATTTTATTCAGAATCTAACGGTTTTTCAAACCCCCAAACATC GAAAGCGACATCCATGAATTGAGTTTGAACTCAAGACTTTTTCCCACATA ATTCAGCACTGCCCGGATGAAAATTTTCAAAACGCACTCCTCTTTTCCCG ACTCACAAATCCCTTTCAATCTTTAAAGCAGGAGCCCAATGCAATTTAAT TACGACGATTTAATAGCATAGAATTTGCCGTTTTGAATGTATTCGCGAGT GAGAAACGAGTGAAGGGCATACACACGCAACAAACTCGTCTTCTTATATA AGCCATCCGCTGTAACGTTTGCCCACTGAGAGCTGCATAAGCTTTTGCCT TCGATGCGACTCGCGAGCCACGCTTGACTCGATTTAATGCTCAATTACTT AGATATTTTGACGATTAAATTCTCCATATCTCGTCAGGCGATATGCTGCA AAGAGTCGAACTGAGGCAAAGCGCCATGGAGAGATGCGAAAACATCAGCA TCGCAACCGTTAATGGGATATGCACCGAGCCTGCTTACTCTATGGACGAC TGCAGCGTAAGTCCAAACATTTTTTTGATGACTGGATCCTCAGATTGAAA TGTTGTGTTTGATGGATGAAACTAAAATTGATTCGGATAAAATTCAACGT GAATAAAGTTTCATCGCTAAAAAATGACTTGCGATCAACGAAGAGCTAAT CAAGGTCGTTACGAGAGATTAAAATCAAGAAGGTGGAAAGAGATTCGAAT GAGGTTTTGTTAAAAGGGTGCAAAACAATGTCGCTTTTTTCTTTATTTTC ACACGAAGGAGGAGGAATTAGCTGGAAGTCCGATGCTGTGTTTGCTAAAC GATGAGAGGCGTTGGGCCCTCGCGGGAGTCGCGAGTTGGCGAATAGCGTG TTCGAAAACCGGCACCGAGAGGCCTCGTCTGTACGATCAAGTATCGACGA ATATTGCCTGGATCCGATCGACCATAAGTTGAAAGTGACCAGGGCGATCG ACATCGGAATAAATGCATTTGACACCCGAGAGAACGATCCTGAGCCTGGG AAAAACAATCTTGAGAATGGGATCGAATGACGTCAGGGTCGACGAAGCAA CGTGGAAGAAAAAGTCGACCAGAATTTCTCGAAATCGTACGCTTTCATTG TCGAATCAGGGGAAAATCCAATTTCAATTTTTATTTCATATAATTACAAT GCCCAATAAATCTGAATACATTTCTGTTACGAAAGCAAACTCGACCTCTT ACGAAAGAGATAGAAACTACCGATGGCAAACAAAGCCGAGGTCGCCACTC AAAATCCAACGATCAAGATTCACTGTATTACTTCTCAACGGCTCACGTCC CAGCTGCATTCAAACGTGATAATGTTATAAAACAAGTTTGCGTTTTACTG CTAATTTTCAATCGATACAATCAATCTGGTCCATTGAATTTATTGCTGTT TCTGCGGAGCAAAGCAGTTATTAAATGAGACTGTCAAATATTAGAACATA ACAAGAAATACGTCCTGAATAATGACTCGTTTATTTCACTCATTTTCTTT ATTTTTAATGTTCATTTTGTGAAAAATGTTTCTTTTTTCGTTTATTTTCT ATAGGAACGGACTCATTTCTATCAGATTCCACAGCAAAGATGCAGTTATT GTAATTACTATGATTCGAATGAAATTGTTATTGCACGATCGAAAAATAGT TCGAAAGGAGCTTAAATCATTGGAGCTCGCTCCGTTTTGTATATATTTTA TAGTGTAATGACGTAGGTTTATGTATTGAAAAAAAATTGAAATTTTGGAG TTTTAAGAAATCATGAATTTCGTAGCTTTTAGATTTTTTATTCGCCATCC CAATTTTGTGACGCGTAAAGTCCCTCCAATACTGTAAACATTGTTGTACC TATAATTGTATTGTTACTTCGTTAATATTGAAAAAATATAAAATTGTATT TTAGTACTGATGAGTTCTCGTTCGTTTTTCCTTATTTTCTCGACGATCGT CAACAACTTTTCTCCGGCCGGGACAACGAGGTACAAAAACATGGGAATAA ACGTGCTAAACAAACTAAATTGGCAAGCGGCGAGTTTACTGTCGTTGAAA AAGTCAGAATTCCGGATTTTTTGCTGAAATTTATTCTCGAACTCGTCACT TCCAATTGAATCGTAAAAGTACAGAAAAAGAGGGTCGAGGTTCGGGGAAA ATGTTGAAGAAAGAATTCGTGCATCGATGCATTATTACTCGACAACAATC GACCCCACAACGAATGTTATGACAACTAAACCTTTGAATTTATAATCTCG TGACGCAACTCGAGCTCGAACGAATGGCCAAGTAAACCGAAAGCGTGAGA AGGAGAGAGGGAGAGAGAAGATGCGAGGAGAGAAAAACCTCCTCGGAGCT TCCATGGGCAGTTATGGTGGGAGCCTCGATAGTAGGGTTGCACACCCAAG AGACTGAGGGACTACACAGTGTAAAATGCAAAATCGTCTTTCATTCGCGT TGCTACTGCGGTGGCATCGACCGCGCCAATTGATACCGTGTCCCCAGTGA AAATTAATACCACACGAGTCACTAAGCCGCCCGGTTATTCGACGTATCAA CCACTCATTTCGTATTACCCTTCTTCGTGAGAAATGGTAAGAAACAAAAA GCTTCCTTTTCTTTCTGACACTGCATTTCTCTCGCGATGCTTTTTTCTTT CATTTTCCGAGGACTTTAACCACCCAAGGTCTTGAATTCTTGGTCTATTT TCTCGTATTTATGTGGTTACGTAATTAGCGAGTGCAGGTTGAACACATTT TCATTGATAACTCGAGCTCGATTGGATTTTTTTTTTATTTTTTTTTATTT TTTTTTTTTTATTACTTTCTGTGGCACGAAGTTTGGGAAGGAATTTGAGA GAGAATGTAAAAGTCACGAAAATGCATTTTTCCAATGTTCAGAATAACTT TTCTATCGATTCCACAGTGACGAATGGGTCCAAATATTTTATCTCACAGC TAGTGTGGAGCATTTGAACAAATTTCTTTGTTGGCATTCTCGTAGTTGGT AATGAGGATTTTTCAGCACGCATGCTCGAGAAAAAATGAACGATTTATCG GAGAGAAAGAAGAAAGAAATTTGTACAGCTGCGAAAGCTCGGATACGGTG ATAAAAAACTTGTTTATCAACAGCCACAGCATGTGTGCGATGCTCATTGA AGTTGCGAGGCTTTTGAAAAAATTGAGGCAACGCTAGTTCGGCGATAACG AATCCTACAATTAATCACAGTCCTCAGAATCGCTTGGAAAATGTTGAGCA TTAATGCGAGACTTCGAAGATTCCTCACGCTTGAAATATCGCTCCCAGCG TTGCAATTGATAGGAAATTTATTGTGAGAAATTCCATCTCCTGCGAAGCT CATCGCATGTAATTTTGCTCAAGTGCATCCTTTCATTGGGACTTTTAGAG GAGCCTCGAATCGTTAATCTTCTCTTGGTGGGAGCTCTCGATTTTTGCAA AACCCTTCCATCGAAGCTAATTCGTTCTTGTAATTGTGCATTCAGACTAC TCAAAAAATCAATGGAGTTGAAAAGATCCCGACAAACGATTGCCCAATCG TCGAGAAGACAGTGAAATCAGGATCGTCTGATCTTGCTCGGATCGAAATA AAAACGCAGCATCCTTTGGACCTTTTCAAAGAGTGGCACGAGGAGGCCAA AAAATATTCGAACGGAATACCAAATGCGCTGTGCCTTGCCACCGTTTCCA AGTGAGTTGAAAAAGTATTCGAATCATTTTTAATAAGAAAAATTTTTAAT AAGAAATTATTTCATGAAAAGGGAAATCGCTGCATCAATTTCAAGAACAA CATCGATGATGGTATAAAAAGTTCATTAATTTGTTGATTTTTTCTGTCAA ATTGGATTTTTTGCAGTTTCATTTGATTCTGAAATTTTTATCTGATTCTA TGGTAGAATTATGATTTGTCGCCACCATCATTTGTTTCATTTCCAGGTAG TTTTTCTACAATAGTTTTCCTCAGATTTCTTTATCGACTGAGTCACAGGT AATTTCGTACTATTTGCACCAGTAGGCCAAGCGCTAGAGCTTAAAAATCA CCAGATTTTGACAAAAATAGTAACAGACAACGAGCGGTGGCGTCACCCGC GGAATGGCCTCCAGGACCTAACTGCACAAAAACGTACTCGAGGTTCCCGA ACGCTTTTTTTTTAATTAACGATTTAGTGCTAAAAATCGCATCTTTTTGG TTATTTGTTTATAAAAGAAAAACCGATGGAGCAATGTGAATAGTTTCAAA GGACGAAATGTAGAGAACTAAAATACGAAGAGATTGAGCCCTGGAAAAGC CCGATCGGTCAATTATTAAGGAAGAAAACACAAAAAAACCTAAAAAAATA GGGTTTTTTCAAAAATTCGTAACGCAGCCATTTTTCGAGTTGTAGCGTAG GCTCTTCGCGAAAAAGTTGATATCGATAGGTACTTTTTGTGTGCAAAACC CAGACCCTGTCGGATCATTAATTTTTGCATAATCGCAGTTAGAAGTTTTT TATGCCATATTTTGCAGCGAGGCTGTATGCTCTGCAAGTACTCGGATTAG AATTTATCAAACGGATTTGGAAAGTAGAAGAGTTCAACTACAAAACGTCA ATCTTCGTTTTCCATTCAAGTGCTAAAAATTTGACGAAAATTGTGCACGA ACGCGGTCGTGGAGTGGGGATAGAACAGTAGACGGGGAAATCGTTTATAG TAATACAAGCGCGCTGCACGCGAGTCATGAATCTTCAGATTCGATCATCT CAGCAACTAGTTGTACTACCTTAACATTTTTTTTTCTCATTTTGCGATAA CTGGCCCCACGAAAGCTGATTCTCCATTCTAATTCCATAAAAAATCAGCA GAAATTTTTTTTTTCAGATTTTTTTAGCTACACGTCTTTACATTATTATA ATATAATGTAACTCACACTTTTTAATATTTTATGTACTCCATTTCATACA ATATTGTTTAAAAGTTTAATTTTTGCTTACTTAAACTCAAATTAAGGCTG TTATAAGTTATAAGCAGTTTAAGATTGTCGAAAATAGCATGCTTTTACCT GGAAATCCAGGTAAAGGCATTTATTTCGCTGCAGGGCTTCCCCATTGATG AATTTTGCCCAAAAGTAGGGAGGTACAGTAATCCCCAAGGGACAGGCTCA TAAACCTCGTCCAACCACTTTTCATCGTTACGGTTCCTCGCGTGAATTAG CAGCCAAATGTGCAGCTATTTTGGACAATTTCAAATTCTCGAATGAAAAA ACTCGAAAAATATGGAATTTTAGAATTTGGGTTCCTCGAGGATGGAGAAA CAGTGCGAATAAGATGATTTGCAGATTCTCTTTCCCCTCGTTCTGCTTCC CTCGCTGATTCAATTTGATGATTAACTTGAATCTGTGATTGCAGGGATCT CAGAGTCAGTGCTCGCCACGTGATTCTTCGTGACTACGACGAGCGTGGTT TTGTGATCGTAACGGACAGCCGAAGTCGAAAATCCCACGAATTGGTACGT AAACGACAGTTCGAGATATCTGAATTTAAAAAATTGGCATTTCATCGGGA AAGAGTAAAATTTGACACTCAAAATCGTGATTTTTGTCGTTTTTTTATTT CTCATTGTTTTATCCTCCTTAGGAAGAAGTACCAAAAGCAGCAATGTGCA TTCTTTGGGCCTACCCCAACGAGAAGCATCAAAATATATCGAGACAGGTG AAGAACTAAATAATCAGCCATGAATCGTGGACACTTTTTTACCCAGTAAA AATGAATTCTGTTTATAAGACAAATGTTCACATTGAATATCTGAACGATC CAGGTGAGAATTGAGGGAAATGTCGAAAAGCTGTCCCCCCCAGAATTCCG GTATCTCTACGACCGTGAGCCAGTCTATTGCAAAATCAGATCCTACCTCT GTTGTCAGGGTGAAAAAGTGGATTGGAATAATCAGAAAAACATTCATGAT AAACTGGTGCAAGACGTCCAGGACGGAAAGCAAGATTTGTCGATGCCAGA ACATTTGTAAGTCGACAGATAATCACGAATCCGAAAAATTGCAGATTCGA TATGAAAGAGTCAGTAAAGCGACAAAAAAGTGAATTTTTTTGATGATTTT ATCGGACTCTATTTTCTTCGTTTTTTTTTTTTAAATTGAGCTCGAATGAC AAAAATTTATTGATTGCAGCATCGCGTACAGACTCTGCCCAGAAAGCATG GAATTTTACTTCGCCTACGATCACCTCATAGCCGATCGTCTTCTTTTCAC GAAGGCATCTGACGACTCATCGTGGACGAATCTCAGGATCGCAGCATGA
back to top

Coding sequence (CDS) from alignment at scaffold_1295:1..13249+

>g17085.t1 ID=g17085.t1|Name=g17085.t1|organism=Venturia canescens|type=CDS|length=2642bp|location=Sequence derived from alignment at scaffold_1295:1..13249+ (Venturia canescens)
ATGCGTATCTCATTTCGGATCCACCGAGTGACCAAGTGTTCCTTGCGACG
TTTCGAGTAACAGGTGGTGACTCGTTCACCGTTGACCTCGCAGACCCCTC
GACCGAAGCGTTCAGAATACGTTCCAGGGAATATCGCGATCGCCTTAATC
TGGCCTTTCGTCGGAGCTCGTTCAAGATTTCTTTCATAACCGCCGAAGTC
CTCGCACTCGATGGTATCGAAGGTGGTGATTTGGTCGTCCATTTCGATCT
GAGGTTCGATCCGCGTTACCAGACCTTGACTGTGGAGGACGTGGCTGAAG
TTCTCCTGCGGGAAATAACCCCAGGAAAGGCGAAATATCTGGCAAGTCTG
ACGATCGATCCGAAGAGTCTCGAGGTTCAGGAAAGCATCGCAGCCCTCAA
CGCCGAATCAGCGCTGCAGACGACGGTCTCGACACCACCGACGACGACGA
CGGCACCACCTCCTAGAACTTGCAGCAGAGTGAACCTTCCTTATTGCCGA
CATTTGCCGTACAATGTCACTTCGTATCCGAACGTTCTGGGCCATAAATC
GTTGCTCGAAGTTGAGGAGGATCTCATAGCTTTTCGAGAATTAGTGGATG
CGGAGTGCTACAGATTGGCCTACGATTTCATATGCCAAGTTCTCCAACCC
GCGTGTGTACCCGGCCACGCGGAAGCTGCTCTGCATCTACCGTGTCGAAG
CTTCTGTCGAGAATTCTGGGCCGGGTGCGGCAACCGCTTGCCGGATAAAA
TCAAATCTGCAATCGACTGTTCGAACTTTCCTGAGTACGCTGATCATGGC
AGTTGCAGGCCGAAGCCAGGCTGCGTTCGAGACTTGCAGAGCAAAGCATT
GTCGCCTCGTATCTGCGACGGTGTAATCGACTGCCCTGATCTTTCGGACG
AGAAAAACTGCGCTTACTGTCAAGAGGGTTTCATGCACTGTGGTGTCGGC
CGGACGTGCATTTCTCGAGCGAAACGATGCGATGGTAAAATCGACTGTCC
CGGCGGCAGCGACGAGAAAGATTGCCTGTCCCTGGCGAAAAGTGTCAACT
CGATGAAATCTCAGCTAACGGAAACTCCGCTATCTTCGAAGTACACCCGC
GAAGGCTACGTCGTTTTCAACGAGAAAGGAACCGTTGGCAAACTGTGCAC
AGAAAATTTAAACGCCACTTTACCGGAAACGGAAATGGACAACGTTCTCC
GAAGCTCTGCCAGCTCGCTCTGCAATCTGCTGACATACACGGGCCTGGAC
ACGGTCGAAATCAAAGTCGACGAAGAAAAAGACATTCAGTACGTTCACAT
GGAGGATCCTTCAGCGTCCGAAATAACTTTCGTCAGAGCTCCTTGCCCGA
GCAAGCAAGTCATGTACGTCCGATGTGCGGACCTCGAATGCGGCCTGCAG
GCCCTGAGGAAAGGAGGAGGAACCGAAGGCCTCAGCAAAATGTCCGAACC
CGGAGACTGGCCTTGGCACGCTGCCCTCTTCAAAGAAGACGTCCACGTGT
GTGACGCGACTCTCGTCGCAGCTGAGTGGCTCCTGACGACAGCTTCGTGT
TTCCAGGGACAAGACAAAGCGGAATGGAGTGCACGTTTGGGGACGGTCAG
ATTGACGAGTACTTCGCCATGGCAACAGGAGAGAAGAATCGTGGGGATGT
TGAAGTCACCGGTGGAAGGAAGCACGATGGTTCTGCTGAAGCTGGACCGA
CCATTGTCCGCGTATTCGGATTTCGTTCGCCCAGTTTGCCTGCCATCGAG
TGACGAGCCGATGCTAGCGAATGCCACTTATTGCACGACCCTCGGATGGG
CCAGGAATCGCGATATGCTGCAAAGAGTCGAACTGAGGCAAAGCGCCATG
GAGAGATGCGAAAACATCAGCATCGCAACCGTTAATGGGATATGCACCGA
GCCTGCTTACTCTATGGACGACTGCAGCACTACTCAAAAAATCAATGGAG
TTGAAAAGATCCCGACAAACGATTGCCCAATCGTCGAGAAGACAGTGAAA
TCAGGATCGTCTGATCTTGCTCGGATCGAAATAAAAACGCAGCATCCTTT
GGACCTTTTCAAAGAGTGGCACGAGGAGGCCAAAAAATATTCGAACGGAA
TACCAAATGCGCTGTGCCTTGCCACCGTTTCCAAGGATCTCAGAGTCAGT
GCTCGCCACGTGATTCTTCGTGACTACGACGAGCGTGGTTTTGTGATCGT
AACGGACAGCCGAAGTCGAAAATCCCACGAATTGGAAGAAGTACCAAAAG
CAGCAATGTGCATTCTTTGGGCCTACCCCAACGAGAAGCATCAAAATATA
TCGAGACAGGTGAGAATTGAGGGAAATGTCGAAAAGCTGTCCCCCCCAGA
ATTCCGGTATCTCTACGACCGTGAGCCAGTCTATTGCAAAATCAGATCCT
ACCTCTGTTGTCAGGGTGAAAAAGTGGATTGGAATAATCAGAAAAACATT
CATGATAAACTGGTGCAAGACGTCCAGGACGGAAAGCAAGATTTGTCGAT
GCCAGAACATTTCATCGCGTACAGACTCTGCCCAGAAAGCATGGAATTTT
ACTTCGCCTACGATCACCTCATAGCCGATCGTCTTCTTTTCACGAAGGCA
TCTGACGACTCATCGTGGACGAATCTCAGGATCGCAGCATGA
back to top