g17086.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg17086.t1
Unique Nameg17086.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1295contigscaffold_1295:14238..22337 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g17086g17086Venturia canescensgenescaffold_1295 14238..22337 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17086.t1g17086.t1-PAVenturia canescenspolypeptidescaffold_1295 14238..22337 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17086.t1-start_codong17086.t1-start_codonVenturia canescensstart_codonscaffold_1295 14238..14240 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17086.t1-CDSg17086.t1-CDS-1Venturia canescensCDSscaffold_1295 14238..14340 +
g17086.t1-CDSg17086.t1-CDS-2Venturia canescensCDSscaffold_1295 15598..15736 +
g17086.t1-CDSg17086.t1-CDS-3Venturia canescensCDSscaffold_1295 15822..16122 +
g17086.t1-CDSg17086.t1-CDS-4Venturia canescensCDSscaffold_1295 16210..16526 +
g17086.t1-CDSg17086.t1-CDS-5Venturia canescensCDSscaffold_1295 16711..17275 +
g17086.t1-CDSg17086.t1-CDS-6Venturia canescensCDSscaffold_1295 17376..17609 +
g17086.t1-CDSg17086.t1-CDS-7Venturia canescensCDSscaffold_1295 17727..18371 +
g17086.t1-CDSg17086.t1-CDS-8Venturia canescensCDSscaffold_1295 18688..19240 +
g17086.t1-CDSg17086.t1-CDS-9Venturia canescensCDSscaffold_1295 19413..19788 +
g17086.t1-CDSg17086.t1-CDS-10Venturia canescensCDSscaffold_1295 20800..21226 +
g17086.t1-CDSg17086.t1-CDS-11Venturia canescensCDSscaffold_1295 21501..21699 +
g17086.t1-CDSg17086.t1-CDS-12Venturia canescensCDSscaffold_1295 21845..21996 +
g17086.t1-CDSg17086.t1-CDS-13Venturia canescensCDSscaffold_1295 22092..22337 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17086.t1-exong17086.t1-exon-1Venturia canescensexonscaffold_1295 14238..14340 +
g17086.t1-exong17086.t1-exon-2Venturia canescensexonscaffold_1295 15598..15736 +
g17086.t1-exong17086.t1-exon-3Venturia canescensexonscaffold_1295 15822..16122 +
g17086.t1-exong17086.t1-exon-4Venturia canescensexonscaffold_1295 16210..16526 +
g17086.t1-exong17086.t1-exon-5Venturia canescensexonscaffold_1295 16711..17275 +
g17086.t1-exong17086.t1-exon-6Venturia canescensexonscaffold_1295 17376..17609 +
g17086.t1-exong17086.t1-exon-7Venturia canescensexonscaffold_1295 17727..18371 +
g17086.t1-exong17086.t1-exon-8Venturia canescensexonscaffold_1295 18688..19240 +
g17086.t1-exong17086.t1-exon-9Venturia canescensexonscaffold_1295 19413..19788 +
g17086.t1-exong17086.t1-exon-10Venturia canescensexonscaffold_1295 20800..21226 +
g17086.t1-exong17086.t1-exon-11Venturia canescensexonscaffold_1295 21501..21699 +
g17086.t1-exong17086.t1-exon-12Venturia canescensexonscaffold_1295 21845..21996 +
g17086.t1-exong17086.t1-exon-13Venturia canescensexonscaffold_1295 22092..22337 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17086.t1-introng17086.t1-intronVenturia canescensintronscaffold_1295 21997..22091 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17086.t1-stop_codong17086.t1-stop_codonVenturia canescensstop_codonscaffold_1295 22335..22337 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g17086.t1 ID=g17086.t1|Name=g17086.t1|organism=Venturia canescens|type=mRNA|length=4257bp|location=Sequence derived from alignment at scaffold_1295:14238..22337+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGCGTAATGATCACGGGAACGACGCTTATCTTTTACTCGAGAATGGCAG
CGTATTTCCCGGCAAAAAATTCGGCGCCCATGTTCCCGTGGACGGCGAAG
TTGTTTTCCAGACGGGTATGGTCGGGTACCCGGAGTCCTTGACAGATCCA
TCGTACCACGCCCAGATTCTCGTGCTGACTTACCCCTTAATAGGGAATTA
CGGTGTGCCTGGTAAAGAGAAAGACGAGAACGGATTGTTGTGTTGGTTCG
AGTCGGACAAAATATGGGCAGCTGGCTTGATAGTTGGTGAGCTTTGTCAG
ACGCCGTCTCACTGGCGACAGACAGAGACGCTTTCGGCATGGATGGCGCG
AGAAAAGGTGCCCGGAATCTGCGACGTCGACACGAGAGCACTGACGAAAG
TAATCCGAGAAAAAGGGAGCATGACCGGGAGGATAATTTGCCAACCTCCG
CCGACGAGCTGCTCGAATCCGTACCAGATGACGATGGAGGCACCGGCGAT
AGACGACCCTAACCGGAGGAACCTGGTTGCCGAAGTGTCGAGAACGTCAC
CGATGACCTTCAACCCCACCGGACATCCCAAAATATGCGTGGTCGATTGT
GGGCTGAAATACAATCAACTGCGATGTTTCCTCAAAAGAGGAGCCCGCGT
CGACGTCGTGCCCTGGAACCACGACCTCGGGAGCGTCGAATACGACGGTC
TTTTCCTGAGCAACGGACCGGGCGACCCGAACATGTGCAAAACGACGATC
GTCAACTTGAGAAAAGTTCTCGGACAAACGAAGGTCAAACCGATCTTTGG
TATCTGCATGGGTCACCAGTTACTCGCCTTGGCTGCAGGGTGCCAAAGCT
ACAAATTAGCCTACGGTAACCGTGGGCACAATCAGCCAGTGATCCATCAC
AGCACGAAACGTTGTTACATGACGTCCCAGAACCATGGATTCGCGATCGA
CTCCACGAAGTTGCCAGACGGTTGGGAGGAGTTGTTCACCAACGCGAACG
ACGGAAGCAACGAGGGGATCGTCCACAAGACTCTCCCCTATTTCTCGGTT
CAATTCCACCCCGAGCACACGGCAGGACCCGAAGACCTCGAGTGCCTTTT
CGACGTATTTCTTCAAACGATTGAGACTCGGACGACGAGCAAGAGCGTAA
CGATGAAGCAGAGACTCGACGAAGCGTTGATCTACAGGCCGATCGGTTCG
TCCAATGATACGAGACCGAGGAAAGTTCTGATCCTCGGCTCCGGGGGCCT
CAGCATTGGACAAGCCGGAGAATTCGACTATTCTGGATCGCAAGCTATCA
AAGCGCTTCAGGAAGAAAACATTCAAACCGTTTTGATCAATCCGAACATC
GCTACTGTTCAAACTTCCAAGGGCATGGCAGACAAAGTTTACTTTCTTCC
AATTATTCCACAGTACGTCGAAGAGGTGATAAGGTCGGAGCGACCGGACG
GAGTGTTACTGACCTTCGGTGGCCAAACAGCTCTCAATTGCGGAGTGGAG
CTCGAGCAGAGAGGCGTTTTTAAGGAGTACCAGGTGAAAATTTTGGGAAC
GCCCATTCAGTCGATCATTGACACGGAGGATCGGAAAATTTTTGCCGAAA
GAATCAGTACGATCAACGAAAAAGTTGCTCCCAGCGCGGCTGTCTACTCG
ATTCAGGAGGCTCTGGAAGCGGCAGAAAAGTTGGGATACCCGGTAATGGC
CCGAGCAGCTTTTTCCCTCGGCGGTTTGGGCTCAGGTTTCGCGAACACGA
AAGAAGAGCTCAAGACGTTGGCGCAGCAGGCGTTGGCTCATTCTAGTCAG
TTGATAATAGACAAATCGTTGAAAGGGTGGAAGGAAGTTGAGTACGAAGT
GGTGAGAGACGCCTTCGACAATTGCATAACGGTGTGCAACATGGAGAACG
TAGATCCACTGGGAATTCACACGGGGGAATCGATCGTGGTTGCACCGAGC
CAGACTCTCTCGAACCGGGAGTACAACATGCTCAGAACCGCTGCCATCAA
AGTTATTCGACACTTTGGAATAGTCGGCGAGTGCAACATTCAGTACGCTC
TAAATCCCTTCTCCGAGGAGTATTACATCATCGAAGTGAACGCGAGGTTG
TCGAGGAGCTCGGCACTGGCGAGCAAAGCGACGGGATATCCGTTGGCTTA
CGTCGCCGCGAAACTCGCCCTGGAAATTCCGTTGCCTCGGATCAACAACT
CCGTCACTGGAAAAACTACCGCCTGCTTCGAACCCAGCCTCGATTATTGT
GTCGTCAAAATACCGCGATGGGATCTGAGCAAATTCCAACGCGTCAGCAC
CAAGATCGGAAGTTCGATGAAGAGCGTCGGCGAGGTGATGGCGATCGGCA
GGAAGTTCGAGGAAGCGTTTCAAAAAGCCCTGCGAATGGTGGACGACAAC
GTGACAGGATTCGATCCCTACGCGAAGGCGGTGAACGAAGAGGAGCTGGA
AAAGCCAACTGACAAGAGAATGTTCGTTCTCGCAGCTTCGATAAAAGCCG
GCTACACGGTCGACCGCCTCTACGAGCTGACGAAAATCGACCGGTGGTTC
CTCGAGAAAATGAAAAACATTATCGAGTATTACACCCTTTTGGAAAATCT
CGGATTGGCCAGGCTCACACCCGCCGTGCTCCTCGGCGCCAAACAATTCG
GCTTTTCCGACAAACAAATCGCCGGCGCTGTCAAAGGCGCCATACTCGAT
GTACGCAAGCAACGGAGGGAGAGCAACATTCACCCTTTTGTTAAACAAAT
CGACACGGTCGCTGCCGAATGGCCGGCAACCACGAACTATTTGTATTTGA
CTTACAGTGGCTCGACTCACGACATCGAATTCCCTGGAACTTACACGATG
GTCATCGGTTCGGGTGTCTATCGCATCGGAAGTTCCGTCGAATTTGATTG
GTGCGCTGTGAGCTGCCTCCGCGAACTGCGCAATCTGGGACGCAAGACAA
TAATGGTTAATTACAATCCAGAAACCGTCAGCACCGATTACGACATGTCC
GATCGTCTCTACTTTGAAGAAATTTCTTTCGAAGTTGTAATGGACATTTA
CCAGCTCGAAAATCCCGTGGGCATCATACTCTCCATGGGAGGTCAATTGC
CCAATAACATTGCCATGGATCTCCACAAACAACAAGCCAAAATCCTTGGC
ACTTCTCCAATCAATATCGACGAAGCTGAGGATCGATTCAAATTCTCAAG
GACTCTGGATCGCATCGAAGTCTCACAGCCACGATGGAAAAAATTGACGG
ACTTGAAATCAGCGATAGAATTTTGTGAAGAAGTGGGTTACCCGTGCTTG
GTGAGACCATCGTACGTTTTGAGTGGCGCCGCGATGAACGTGGCACATTC
GGCCCAGGACCTGGAATCGTATTTGAAGAATGCCAGTGACGTCAGTAACG
AGCATCCGGTTGTCATTTCGAAATTCATCCTCGAAGCAAAAGAGATCGAT
GTGGACGCGGTTGCCTATCAGGGCGTCATATTCTGCATGGCTATTTCGGA
ACACGTTGAAAACGCTGGTGTTCACTCGGGCGATGCGACCCTCGTCACTC
CACCGCAGGATATAAATCCCGAAACACTCGCCAAAATACAAAGCATCACG
AAAGCGATTGCACTTGCCCTCGACGTCACGGGGCCATTCAACATGCAATT
GATCGCTAAAGACAACGAGCTGAAGGTCATCGAGTGCAACGTCCGAGTCT
CTCGGTCTTTCCCATTCGTCTCAAAGACCCTGGACCACGATTTCGTGGCG
ATGGCGACTCGTCTCATAGTCGGCGACACCGTTGACCCCGTCGACATACT
TCGCGGATGCGGAAAAGTCGGAGTCAAAGTTCCGCAATTTTCTTTCTCGC
GGCTGGCTGGGGCCGATGTCATGTTGGGCGTCGAAATGGCGTCGACCGGT
GAAGTCGCTTGTTTCGGTGACAACAGGTACGAAGCTTATTTGAAGGGGAT
GATGAGCACCGGTTTCCACATACCGGAGAAAGGAATTCTCCTCTCAATTG
GCAGTTTCAAGCACAAAATGGAGTTGCTACCTTCCATCGAGAACCTTTAC
AAAATGGGCTACAAGTTGTACGCGAGCATGGGAACGGCAGATTTCTACAC
GGAGCACGGCGTTGCGGTGAGTAAACAAAGCTTTCTATTAGATGAAAAAA
TATTTACAGGAAAGCTTTGGATCGATGGAGAAATACCGAAGATAAAAGTC
CTCATCAATTTTTCTCTACGACGCATCGTTGCTAAGTTATCGATTAAAAA
GCAGTAA
back to top

protein sequence of g17086.t1

>g17086.t1-PA ID=g17086.t1-PA|Name=g17086.t1|organism=Venturia canescens|type=polypeptide|length=1418bp
MRNDHGNDAYLLLENGSVFPGKKFGAHVPVDGEVVFQTGMVGYPESLTDP
SYHAQILVLTYPLIGNYGVPGKEKDENGLLCWFESDKIWAAGLIVGELCQ
TPSHWRQTETLSAWMAREKVPGICDVDTRALTKVIREKGSMTGRIICQPP
PTSCSNPYQMTMEAPAIDDPNRRNLVAEVSRTSPMTFNPTGHPKICVVDC
GLKYNQLRCFLKRGARVDVVPWNHDLGSVEYDGLFLSNGPGDPNMCKTTI
VNLRKVLGQTKVKPIFGICMGHQLLALAAGCQSYKLAYGNRGHNQPVIHH
STKRCYMTSQNHGFAIDSTKLPDGWEELFTNANDGSNEGIVHKTLPYFSV
QFHPEHTAGPEDLECLFDVFLQTIETRTTSKSVTMKQRLDEALIYRPIGS
SNDTRPRKVLILGSGGLSIGQAGEFDYSGSQAIKALQEENIQTVLINPNI
ATVQTSKGMADKVYFLPIIPQYVEEVIRSERPDGVLLTFGGQTALNCGVE
LEQRGVFKEYQVKILGTPIQSIIDTEDRKIFAERISTINEKVAPSAAVYS
IQEALEAAEKLGYPVMARAAFSLGGLGSGFANTKEELKTLAQQALAHSSQ
LIIDKSLKGWKEVEYEVVRDAFDNCITVCNMENVDPLGIHTGESIVVAPS
QTLSNREYNMLRTAAIKVIRHFGIVGECNIQYALNPFSEEYYIIEVNARL
SRSSALASKATGYPLAYVAAKLALEIPLPRINNSVTGKTTACFEPSLDYC
VVKIPRWDLSKFQRVSTKIGSSMKSVGEVMAIGRKFEEAFQKALRMVDDN
VTGFDPYAKAVNEEELEKPTDKRMFVLAASIKAGYTVDRLYELTKIDRWF
LEKMKNIIEYYTLLENLGLARLTPAVLLGAKQFGFSDKQIAGAVKGAILD
VRKQRRESNIHPFVKQIDTVAAEWPATTNYLYLTYSGSTHDIEFPGTYTM
VIGSGVYRIGSSVEFDWCAVSCLRELRNLGRKTIMVNYNPETVSTDYDMS
DRLYFEEISFEVVMDIYQLENPVGIILSMGGQLPNNIAMDLHKQQAKILG
TSPINIDEAEDRFKFSRTLDRIEVSQPRWKKLTDLKSAIEFCEEVGYPCL
VRPSYVLSGAAMNVAHSAQDLESYLKNASDVSNEHPVVISKFILEAKEID
VDAVAYQGVIFCMAISEHVENAGVHSGDATLVTPPQDINPETLAKIQSIT
KAIALALDVTGPFNMQLIAKDNELKVIECNVRVSRSFPFVSKTLDHDFVA
MATRLIVGDTVDPVDILRGCGKVGVKVPQFSFSRLAGADVMLGVEMASTG
EVACFGDNRYEAYLKGMMSTGFHIPEKGILLSIGSFKHKMELLPSIENLY
KMGYKLYASMGTADFYTEHGVAVSKQSFLLDEKIFTGKLWIDGEIPKIKV
LINFSLRRIVAKLSIKKQ
back to top

mRNA from alignment at scaffold_1295:14238..22337+

Legend: polypeptidestart_codonCDSexonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g17086.t1 ID=g17086.t1|Name=g17086.t1|organism=Venturia canescens|type=mRNA|length=8100bp|location=Sequence derived from alignment at scaffold_1295:14238..22337+ (Venturia canescens)
ATGCGTAATGATCACGGGAACGACGCTTATCTTTTACTCGAGAATGGCAG CGTATTTCCCGGCAAAAAATTCGGCGCCCATGTTCCCGTGGACGGCGAAG TTGGTGGGTTTTATTGTTATTGTTGTTCGTTTGTTTAAACAAAAATCTTA ACCTACGAAGCTCGAGGAGCGATGCTCAATCGAGGATTCAATTAAAGTTT AGAACTGTGCGTTTCGATCATAGCAACACGTGGTCTTCGAACCGCTCCAT TTTTTTGTGTTCTCGAGTGCCGAGATACGACGGTTTCGCTTTTTTTTCTC GTGTCAGAAAATATTTTCGAGTGATTGAAAAATACTCGTTTCCTTTTAAA ATGACGATTGGAAGAGATGTAAATTTTTGCAGAAGAATAAATTTCTATAG AGTTTATTAATATATTAACGTAGAAAAATAGTTGACTGTGATTTTTTCAA ATATTTATCGCCCCACGATCGCTCTTTCTTTGTAATAATCGTCAAGTGAA TTTGATTTTAATAGTTTTTCTCGAATAATTATTTACCGAACGTTGTATAA TACGCTGTTGATAAAATTTGAATTATTCCAAATTTAGAATTTTCTACAAC GAGAAAAAATGGTTTATTTTGACGATTCAATTTCTGAGCTACTTTGCCGG CATTTTCTGATACCGTAAATCGAGTCGGTTGTTCCTTAAACATAAGAGAA TGAAATTCCAGCGTACGATTGAAAAAAAAATCGTGAAAAACGTTTCCTTG AGTAGAGCACCGGGAACGAAAATGAATAAATTTAGAAAAAAGCCACAATC GAGTTGGAACGTAAGTCGAATTGAAGAAGAAACTTTGACGTCGGATGCTT CGAAAGTAACATCGTGAGCCTCACTGCCGCACGTTGCTGCGCCACCAACC CACGCATTCAATGTCTCCCCCCTCCGGCGCCGTGCGCCGTTTCGTCAAAA AAATTTTTCCTCCGCGCACCTACGAACTTTGAAATATTTCGTTCCCTCAA AACAGGCTTTCCCTATTTTTTCTATCTTTCAAAAACGATCTCGTTGTAAA TCGGAAACCGAACAATCGCCAATAAACAAAATTGACGATGAACAATTGAG GACGCGAAACTAACGAAAAGTTCGTAACTCAATCGATGGACAGATGAAAC AAAAAATCTTCTTCTCATACCAAAACAAAATAATTTGAAAAAAGCTGAAA AGAAATGTAATTTCCCCAAATTTCATGTAAATTCAGTTGCAACGTTTGAA TTATTCGAAAATTCAATTCTATATCGAAACAAAACAATCATTTTGATCCC GATCCAAAAACAATGACGAAGAATTCGAGAAACGAAGTCAAATTTGGGTC TGTCGTTCAGTTTTCCAGACGGGTATGGTCGGGTACCCGGAGTCCTTGAC AGATCCATCGTACCACGCCCAGATTCTCGTGCTGACTTACCCCTTAATAG GGAATTACGGTGTGCCTGGTAAAGAGAAAGACGAGAACGGATTGTTGTGG TGAGTTTGAAAAAAATGCGATTTGCAGCTCGACAATTGTCAGCGATAAAC TTTCACGTTTCGTTAAACTGCTTCCGTCGAGCAGTTGGTTCGAGTCGGAC AAAATATGGGCAGCTGGCTTGATAGTTGGTGAGCTTTGTCAGACGCCGTC TCACTGGCGACAGACAGAGACGCTTTCGGCATGGATGGCGCGAGAAAAGG TGCCCGGAATCTGCGACGTCGACACGAGAGCACTGACGAAAGTAATCCGA GAAAAAGGGAGCATGACCGGGAGGATAATTTGCCAACCTCCGCCGACGAG CTGCTCGAATCCGTACCAGATGACGATGGAGGCACCGGCGATAGACGACC CTAACCGGAGGAACCTGGTTGCCGAAGTGTCGAGAGTAAGTTCAGGTTTC GAGGTGACTCGAAATCGAAATTTGATCGATTCAGGTGACTGACCGGCTCC TGCCTTAACCGTGCCTTTCCAGACGTCACCGATGACCTTCAACCCCACCG GACATCCCAAAATATGCGTGGTCGATTGTGGGCTGAAATACAATCAACTG CGATGTTTCCTCAAAAGAGGAGCCCGCGTCGACGTCGTGCCCTGGAACCA CGACCTCGGGAGCGTCGAATACGACGGTCTTTTCCTGAGCAACGGACCGG GCGACCCGAACATGTGCAAAACGACGATCGTCAACTTGAGAAAAGTTCTC GGACAAACGAAGGTCAAACCGATCTTTGGTATCTGCATGGGTCACCAGTT ACTCGCCTTGGCTGCAGGGTGCCAAAGCTACAAATTAGCGTGAGTCGTTT TGTTTTCACCTAGAAATGAGCCGTCGAAACTCCTTGGATTTTGACTTCCA ATCATTGGTCTTCAAGGAATAGAAACATTTTTTTTCAATTTAAAAAATGT TTGATTGAATTTTTTAATCAATTTAATCAAAACCCTCGATCGTTGAATCG TCGATTCTCTTGACTTTTTCCAGCTACGGTAACCGTGGGCACAATCAGCC AGTGATCCATCACAGCACGAAACGTTGTTACATGACGTCCCAGAACCATG GATTCGCGATCGACTCCACGAAGTTGCCAGACGGTTGGGAGGAGTTGTTC ACCAACGCGAACGACGGAAGCAACGAGGGGATCGTCCACAAGACTCTCCC CTATTTCTCGGTTCAATTCCACCCCGAGCACACGGCAGGACCCGAAGACC TCGAGTGCCTTTTCGACGTATTTCTTCAAACGATTGAGACTCGGACGACG AGCAAGAGCGTAACGATGAAGCAGAGACTCGACGAAGCGTTGATCTACAG GCCGATCGGTTCGTCCAATGATACGAGACCGAGGAAAGTTCTGATCCTCG GCTCCGGGGGCCTCAGCATTGGACAAGCCGGAGAATTCGACTATTCTGGA TCGCAAGCTATCAAAGCGCTTCAGGAAGAAAACATTCAAACCGTTTTGAT CAATCCGAACATCGCTACTGTTCAAACTTCCAAGGGCATGGCAGACAAAG TTTACTTTCTTCCAATTATTCCACAGTACGTCGAAGAGGTGCGCAGAAAT TCATTATCATCCAAACGCCATTTTTCTCGCTTCCATCCGCTTCGCCAGCA CTTCCTTTGAGTCCCTCATAAAATGTTCATTTTTCCAGGTGATAAGGTCG GAGCGACCGGACGGAGTGTTACTGACCTTCGGTGGCCAAACAGCTCTCAA TTGCGGAGTGGAGCTCGAGCAGAGAGGCGTTTTTAAGGAGTACCAGGTGA AAATTTTGGGAACGCCCATTCAGTCGATCATTGACACGGAGGATCGGAAA ATTTTTGCCGAAAGAATCAGTACGATCAACGAAAAAGTTGCTCCCAGCGC GGCTGTCTACTCGATTCAGGAGGTACACGAGACAGAGCATGAGCGATTTA CTTGCGCGGTGCCATTTTTATTGAAAAATTTAAAGTTCTACCAAGATTTT GAACTCCGATGTTTACGCAAATGTTGGCTCTAAAAACAGGCTCTGGAAGC GGCAGAAAAGTTGGGATACCCGGTAATGGCCCGAGCAGCTTTTTCCCTCG GCGGTTTGGGCTCAGGTTTCGCGAACACGAAAGAAGAGCTCAAGACGTTG GCGCAGCAGGCGTTGGCTCATTCTAGTCAGTTGATAATAGACAAATCGTT GAAAGGGTGGAAGGAAGTTGAGTACGAAGTGGTGAGAGACGCCTTCGACA ATTGCATAACGGTGTGCAACATGGAGAACGTAGATCCACTGGGAATTCAC ACGGGGGAATCGATCGTGGTTGCACCGAGCCAGACTCTCTCGAACCGGGA GTACAACATGCTCAGAACCGCTGCCATCAAAGTTATTCGACACTTTGGAA TAGTCGGCGAGTGCAACATTCAGTACGCTCTAAATCCCTTCTCCGAGGAG TATTACATCATCGAAGTGAACGCGAGGTTGTCGAGGAGCTCGGCACTGGC GAGCAAAGCGACGGGATATCCGTTGGCTTACGTCGCCGCGAAACTCGCCC TGGAAATTCCGTTGCCTCGGATCAACAACTCCGTCACTGGAAAAACTACC GCCTGCTTCGAACCCAGCCTCGATTATTGTGTCGTCAAAATACCGCGATG GGATCTGAGCAAATTCCAACGCGTCAGCACCAAGGTATTTCTCTAGTTTT CTTTTGGCATAAAAAAACGTTGAACATCGACATTTTCCGACTGGTCGGAT CGAAAAAAGCTGGAGCAATGAAACAAATTTTTAAACGGAGCCAAAAATAT GCATTCTCATGACAAACTCCTTTAAAAGTTACGCGACAATGAACATTTGT CATCATAAATTGACGGGTTTGGTAATTTTCATCGATTTTTGTCTCAAGCT CTTGTTTTTCTAAGCAGGATCCACCGGGAATGAATTTCCGGAGCGAATCG ATGTGCCGGCGAGGAGTTTCAGGTACTAATTCTATTTTTAATGCCCTCAG ATCGGAAGTTCGATGAAGAGCGTCGGCGAGGTGATGGCGATCGGCAGGAA GTTCGAGGAAGCGTTTCAAAAAGCCCTGCGAATGGTGGACGACAACGTGA CAGGATTCGATCCCTACGCGAAGGCGGTGAACGAAGAGGAGCTGGAAAAG CCAACTGACAAGAGAATGTTCGTTCTCGCAGCTTCGATAAAAGCCGGCTA CACGGTCGACCGCCTCTACGAGCTGACGAAAATCGACCGGTGGTTCCTCG AGAAAATGAAAAACATTATCGAGTATTACACCCTTTTGGAAAATCTCGGA TTGGCCAGGCTCACACCCGCCGTGCTCCTCGGCGCCAAACAATTCGGCTT TTCCGACAAACAAATCGCCGGCGCTGTCAAAGGCGCCATACTCGATGTAC GCAAGCAACGGAGGGAGAGCAACATTCACCCTTTTGTTAAACAAATCGAC ACGGTCGCTGCCGAATGGCCGGCAACCACGAACTATTTGTATTTGACTTA CAGTGGCTCGACTCACGACATCGAATTCCCTGGAACTTACACGATGGTCA TCGGTGAGGATCGTTTTTTTCTGCTGCTTCTAAACTGTGGTTTCGAACGA CGATTTTTCCTTCTGATTGCTTTTTTATTAATTTTTTTCACATATTTTAT CTACAAAATGAACACAATTTTGGAGATTTTTTGCTCGAACGCTTGAATGA TCGAGAAAAATGATTTTTCAAACAGGTTCGGGTGTCTATCGCATCGGAAG TTCCGTCGAATTTGATTGGTGCGCTGTGAGCTGCCTCCGCGAACTGCGCA ATCTGGGACGCAAGACAATAATGGTTAATTACAATCCAGAAACCGTCAGC ACCGATTACGACATGTCCGATCGTCTCTACTTTGAAGAAATTTCTTTCGA AGTTGTAATGGACATTTACCAGCTCGAAAATCCCGTGGGCATCATACTCT CCATGGGAGGTCAATTGCCCAATAACATTGCCATGGATCTCCACAAACAA CAAGCCAAAATCCTTGGCACTTCTCCAATCAATATCGACGAAGCTGAGGA TCGATTCAAATTCTCAAGGACTCTGGATCGCATCGAAGTCTCACAGCCAC GGTGAGTCCCATACAGGAATTCGAAAAGCCCTCGAACGATCCAACGGTCG ATTCGAGCTTGCTTATTCCGACGATAAAATCAAGAATTTTTGTGATTTTC GTTGTTCAAGCTAGACCATCCGTAGGATCGTATTTTATGTCAAAAATGTA TGGTAAATATATTTTTTCAATTTATTTTTCGGCTAATGAAATTACGAGCC ATTAATTGAACGGGCATCCATCACTGACTGAACCCAACATTTCATTCGTC CCTGGCTAAATTACTGCAGTTTTTTCATGTAAAAAATCGCATTAGGGAGC AAAGGAAGCAAAGGAAAATGGATAAAAAAAAAGTGTTAGTAAAAAGACAG AAGGCTTGACCGAAATAAGCAAATGTGAGGTTACGAGTATTCATTTTACC AATTTTATATCTTTATTACTAGCAGGACAATCGTCTCGAATTTTTTCCCA GACTTTCGTTACATACTTCATTGTTATTGTGCCCTTTTTCATAAACTTCA GCGTTCATTCGTTATGTGGAAAGATGAACGATTTTTTACGCATAGTCCCA TAACCCTGTGTATTTTTCTTCATATTTAAACACGTTTGTCTCAATAGCCA ATGAGACGAACCCCTTAAAATTTGATATGCGTTTCAGTCGACTACCGATT CAAACTCTGTCTAAATTTCGAGACTTTCTTAAGGAGTTTTGGTACACAAA AAATATCAAGAAGTCCAGAGTTTTATGGAATTCAGTGATCATATTCTTTA GTAGGAAACTCGACGACACATTTTTTTTTTTTCATTCCGGTCGTAAAAAC TCTGCTTTAATGCTTAATTACTCGATAACTATGGAGAAGAAAATTTGGAA AAAAATGGTGCTTTTGCACTTCATGTTGAAGAACGTCATCACAAAATTTT GTCAATTTCTTATAATTTATAAACACGTATCGAAACTTCTTAAGAAAATC GTTTCGTGCCTGAACTACCTTAACTGATGAAGCTTCAAACGGATGATTTT CGATAATTTCAGATGGAAAAAATTGACGGACTTGAAATCAGCGATAGAAT TTTGTGAAGAAGTGGGTTACCCGTGCTTGGTGAGACCATCGTACGTTTTG AGTGGCGCCGCGATGAACGTGGCACATTCGGCCCAGGACCTGGAATCGTA TTTGAAGAATGCCAGTGACGTCAGTAACGAGCATCCGGTTGTCATTTCGA AATTCATCCTCGAAGCAAAAGAGATCGATGTGGACGCGGTTGCCTATCAG GGCGTCATATTCTGCATGGCTATTTCGGAACACGTTGAAAACGCTGGTGT TCACTCGGGCGATGCGACCCTCGTCACTCCACCGCAGGATATAAATCCCG AAACACTCGCCAAAATACAAAGCATCACGAAAGCGATTGCACTTGCCCTC GACGTCACGGGGCCATTCAACATGCAATTGATCGCTAAAGTTAGTATCCA AACACCGAAAACTCGTCGATTTCCATACTTTTTAGTGAAAAAATGTCATT TTTCGAAACGAAAATTTTGGGGAATACAAAGAAAAAAATTTTTATAAATT TTCTACCGAATCCAAAGGTGTGCTAGTTTCTTTGAATTTGCCATTGAAAA TGCATCAATTTTGCGGTCAATTTCCCAATTATCGTCGCAGTCCAAGACCT AAAATGTGGTTTATTCCGTTCCTGCATGCGATTATAACGAATGAAAAACT TGTCCTTGTACAGGACAACGAGCTGAAGGTCATCGAGTGCAACGTCCGAG TCTCTCGGTCTTTCCCATTCGTCTCAAAGACCCTGGACCACGATTTCGTG GCGATGGCGACTCGTCTCATAGTCGGCGACACCGTTGACCCCGTCGACAT ACTTCGCGGATGCGGAAAAGTCGGAGTCAAAGTTCCGCAATTTTCTTTCT CGCGGCTGGCTGGTAAGTTTTTCACTCGCATTGTCGCAAAAATCACGTGT CAAAATTCACGAAATTTTGCTCTCAATCGACAAGAATTTGTGGAAAGAAA AAAAACTTGGACACTGCAGTTGTGGGATTAAAAGTGTTCGGTTCCGTGAC CTTTCAGGGGCCGATGTCATGTTGGGCGTCGAAATGGCGTCGACCGGTGA AGTCGCTTGTTTCGGTGACAACAGGTACGAAGCTTATTTGAAGGGGATGA TGAGCACCGGTTTCCACATACCGGAGAAAGGAATTCTCCTCTCAATTGGC AGTTTCAAGGTACAACAACCCTCTGAGTCAGGGAGTCATCGAAGTATTCT TTGTAATCGACATTTTTAATGAATCTGAAAAATGGATTTTTCGTTAATTT ACAGCACAAAATGGAGTTGCTACCTTCCATCGAGAACCTTTACAAAATGG GCTACAAGTTGTACGCGAGCATGGGAACGGCAGATTTCTACACGGAGCAC GGCGTTGCGGTGAGTAAACAAAGCTTTCTATTAGATGAAAAAATATTTAC AGGAAAGCTTTGGATCGATGGAGAAATACCGAAGATAAAAGTCCTCATCA ATTTTTCTCTACGACGCATCGTTGCTAAGTTATCGATTAAAAAGCAGTAA
back to top

Coding sequence (CDS) from alignment at scaffold_1295:14238..22337+

>g17086.t1 ID=g17086.t1|Name=g17086.t1|organism=Venturia canescens|type=CDS|length=4257bp|location=Sequence derived from alignment at scaffold_1295:14238..22337+ (Venturia canescens)
ATGCGTAATGATCACGGGAACGACGCTTATCTTTTACTCGAGAATGGCAG
CGTATTTCCCGGCAAAAAATTCGGCGCCCATGTTCCCGTGGACGGCGAAG
TTGTTTTCCAGACGGGTATGGTCGGGTACCCGGAGTCCTTGACAGATCCA
TCGTACCACGCCCAGATTCTCGTGCTGACTTACCCCTTAATAGGGAATTA
CGGTGTGCCTGGTAAAGAGAAAGACGAGAACGGATTGTTGTGTTGGTTCG
AGTCGGACAAAATATGGGCAGCTGGCTTGATAGTTGGTGAGCTTTGTCAG
ACGCCGTCTCACTGGCGACAGACAGAGACGCTTTCGGCATGGATGGCGCG
AGAAAAGGTGCCCGGAATCTGCGACGTCGACACGAGAGCACTGACGAAAG
TAATCCGAGAAAAAGGGAGCATGACCGGGAGGATAATTTGCCAACCTCCG
CCGACGAGCTGCTCGAATCCGTACCAGATGACGATGGAGGCACCGGCGAT
AGACGACCCTAACCGGAGGAACCTGGTTGCCGAAGTGTCGAGAACGTCAC
CGATGACCTTCAACCCCACCGGACATCCCAAAATATGCGTGGTCGATTGT
GGGCTGAAATACAATCAACTGCGATGTTTCCTCAAAAGAGGAGCCCGCGT
CGACGTCGTGCCCTGGAACCACGACCTCGGGAGCGTCGAATACGACGGTC
TTTTCCTGAGCAACGGACCGGGCGACCCGAACATGTGCAAAACGACGATC
GTCAACTTGAGAAAAGTTCTCGGACAAACGAAGGTCAAACCGATCTTTGG
TATCTGCATGGGTCACCAGTTACTCGCCTTGGCTGCAGGGTGCCAAAGCT
ACAAATTAGCCTACGGTAACCGTGGGCACAATCAGCCAGTGATCCATCAC
AGCACGAAACGTTGTTACATGACGTCCCAGAACCATGGATTCGCGATCGA
CTCCACGAAGTTGCCAGACGGTTGGGAGGAGTTGTTCACCAACGCGAACG
ACGGAAGCAACGAGGGGATCGTCCACAAGACTCTCCCCTATTTCTCGGTT
CAATTCCACCCCGAGCACACGGCAGGACCCGAAGACCTCGAGTGCCTTTT
CGACGTATTTCTTCAAACGATTGAGACTCGGACGACGAGCAAGAGCGTAA
CGATGAAGCAGAGACTCGACGAAGCGTTGATCTACAGGCCGATCGGTTCG
TCCAATGATACGAGACCGAGGAAAGTTCTGATCCTCGGCTCCGGGGGCCT
CAGCATTGGACAAGCCGGAGAATTCGACTATTCTGGATCGCAAGCTATCA
AAGCGCTTCAGGAAGAAAACATTCAAACCGTTTTGATCAATCCGAACATC
GCTACTGTTCAAACTTCCAAGGGCATGGCAGACAAAGTTTACTTTCTTCC
AATTATTCCACAGTACGTCGAAGAGGTGATAAGGTCGGAGCGACCGGACG
GAGTGTTACTGACCTTCGGTGGCCAAACAGCTCTCAATTGCGGAGTGGAG
CTCGAGCAGAGAGGCGTTTTTAAGGAGTACCAGGTGAAAATTTTGGGAAC
GCCCATTCAGTCGATCATTGACACGGAGGATCGGAAAATTTTTGCCGAAA
GAATCAGTACGATCAACGAAAAAGTTGCTCCCAGCGCGGCTGTCTACTCG
ATTCAGGAGGCTCTGGAAGCGGCAGAAAAGTTGGGATACCCGGTAATGGC
CCGAGCAGCTTTTTCCCTCGGCGGTTTGGGCTCAGGTTTCGCGAACACGA
AAGAAGAGCTCAAGACGTTGGCGCAGCAGGCGTTGGCTCATTCTAGTCAG
TTGATAATAGACAAATCGTTGAAAGGGTGGAAGGAAGTTGAGTACGAAGT
GGTGAGAGACGCCTTCGACAATTGCATAACGGTGTGCAACATGGAGAACG
TAGATCCACTGGGAATTCACACGGGGGAATCGATCGTGGTTGCACCGAGC
CAGACTCTCTCGAACCGGGAGTACAACATGCTCAGAACCGCTGCCATCAA
AGTTATTCGACACTTTGGAATAGTCGGCGAGTGCAACATTCAGTACGCTC
TAAATCCCTTCTCCGAGGAGTATTACATCATCGAAGTGAACGCGAGGTTG
TCGAGGAGCTCGGCACTGGCGAGCAAAGCGACGGGATATCCGTTGGCTTA
CGTCGCCGCGAAACTCGCCCTGGAAATTCCGTTGCCTCGGATCAACAACT
CCGTCACTGGAAAAACTACCGCCTGCTTCGAACCCAGCCTCGATTATTGT
GTCGTCAAAATACCGCGATGGGATCTGAGCAAATTCCAACGCGTCAGCAC
CAAGATCGGAAGTTCGATGAAGAGCGTCGGCGAGGTGATGGCGATCGGCA
GGAAGTTCGAGGAAGCGTTTCAAAAAGCCCTGCGAATGGTGGACGACAAC
GTGACAGGATTCGATCCCTACGCGAAGGCGGTGAACGAAGAGGAGCTGGA
AAAGCCAACTGACAAGAGAATGTTCGTTCTCGCAGCTTCGATAAAAGCCG
GCTACACGGTCGACCGCCTCTACGAGCTGACGAAAATCGACCGGTGGTTC
CTCGAGAAAATGAAAAACATTATCGAGTATTACACCCTTTTGGAAAATCT
CGGATTGGCCAGGCTCACACCCGCCGTGCTCCTCGGCGCCAAACAATTCG
GCTTTTCCGACAAACAAATCGCCGGCGCTGTCAAAGGCGCCATACTCGAT
GTACGCAAGCAACGGAGGGAGAGCAACATTCACCCTTTTGTTAAACAAAT
CGACACGGTCGCTGCCGAATGGCCGGCAACCACGAACTATTTGTATTTGA
CTTACAGTGGCTCGACTCACGACATCGAATTCCCTGGAACTTACACGATG
GTCATCGGTTCGGGTGTCTATCGCATCGGAAGTTCCGTCGAATTTGATTG
GTGCGCTGTGAGCTGCCTCCGCGAACTGCGCAATCTGGGACGCAAGACAA
TAATGGTTAATTACAATCCAGAAACCGTCAGCACCGATTACGACATGTCC
GATCGTCTCTACTTTGAAGAAATTTCTTTCGAAGTTGTAATGGACATTTA
CCAGCTCGAAAATCCCGTGGGCATCATACTCTCCATGGGAGGTCAATTGC
CCAATAACATTGCCATGGATCTCCACAAACAACAAGCCAAAATCCTTGGC
ACTTCTCCAATCAATATCGACGAAGCTGAGGATCGATTCAAATTCTCAAG
GACTCTGGATCGCATCGAAGTCTCACAGCCACGATGGAAAAAATTGACGG
ACTTGAAATCAGCGATAGAATTTTGTGAAGAAGTGGGTTACCCGTGCTTG
GTGAGACCATCGTACGTTTTGAGTGGCGCCGCGATGAACGTGGCACATTC
GGCCCAGGACCTGGAATCGTATTTGAAGAATGCCAGTGACGTCAGTAACG
AGCATCCGGTTGTCATTTCGAAATTCATCCTCGAAGCAAAAGAGATCGAT
GTGGACGCGGTTGCCTATCAGGGCGTCATATTCTGCATGGCTATTTCGGA
ACACGTTGAAAACGCTGGTGTTCACTCGGGCGATGCGACCCTCGTCACTC
CACCGCAGGATATAAATCCCGAAACACTCGCCAAAATACAAAGCATCACG
AAAGCGATTGCACTTGCCCTCGACGTCACGGGGCCATTCAACATGCAATT
GATCGCTAAAGACAACGAGCTGAAGGTCATCGAGTGCAACGTCCGAGTCT
CTCGGTCTTTCCCATTCGTCTCAAAGACCCTGGACCACGATTTCGTGGCG
ATGGCGACTCGTCTCATAGTCGGCGACACCGTTGACCCCGTCGACATACT
TCGCGGATGCGGAAAAGTCGGAGTCAAAGTTCCGCAATTTTCTTTCTCGC
GGCTGGCTGGGGCCGATGTCATGTTGGGCGTCGAAATGGCGTCGACCGGT
GAAGTCGCTTGTTTCGGTGACAACAGGTACGAAGCTTATTTGAAGGGGAT
GATGAGCACCGGTTTCCACATACCGGAGAAAGGAATTCTCCTCTCAATTG
GCAGTTTCAAGCACAAAATGGAGTTGCTACCTTCCATCGAGAACCTTTAC
AAAATGGGCTACAAGTTGTACGCGAGCATGGGAACGGCAGATTTCTACAC
GGAGCACGGCGTTGCGGTGAGTAAACAAAGCTTTCTATTAGATGAAAAAA
TATTTACAGGAAAGCTTTGGATCGATGGAGAAATACCGAAGATAAAAGTC
CTCATCAATTTTTCTCTACGACGCATCGTTGCTAAGTTATCGATTAAAAA
GCAGTAA
back to top