g17087.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg17087.t1
Unique Nameg17087.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1295contigscaffold_1295:22881..26874 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g17087g17087Venturia canescensgenescaffold_1295 22881..26874 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17087.t1g17087.t1-PAVenturia canescenspolypeptidescaffold_1295 22881..26874 -


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17087.t1-stop_codong17087.t1-stop_codonVenturia canescensstop_codonscaffold_1295 22881..22883 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17087.t1-CDSg17087.t1-CDS-4Venturia canescensCDSscaffold_1295 22881..23453 -
g17087.t1-CDSg17087.t1-CDS-3Venturia canescensCDSscaffold_1295 23534..25254 -
g17087.t1-CDSg17087.t1-CDS-2Venturia canescensCDSscaffold_1295 25686..25987 -
g17087.t1-CDSg17087.t1-CDS-1Venturia canescensCDSscaffold_1295 26591..26874 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17087.t1-exong17087.t1-exon-4Venturia canescensexonscaffold_1295 22881..23453 -
g17087.t1-exong17087.t1-exon-3Venturia canescensexonscaffold_1295 23534..25254 -
g17087.t1-exong17087.t1-exon-2Venturia canescensexonscaffold_1295 25686..25987 -
g17087.t1-exong17087.t1-exon-1Venturia canescensexonscaffold_1295 26591..26874 -


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17087.t1-introng17087.t1-intronVenturia canescensintronscaffold_1295 25988..26590 -


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17087.t1-start_codong17087.t1-start_codonVenturia canescensstart_codonscaffold_1295 26872..26874 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g17087.t1 ID=g17087.t1|Name=g17087.t1|organism=Venturia canescens|type=mRNA|length=2880bp|location=Sequence derived from alignment at scaffold_1295:22881..26874- (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGACCGACAGCTTTCTGAACCTCGACAAATTGGCAATGGGCAACGCTAA
ATCGAAACGGAAAGGTCCCCTCAGCAGGAGCAAAGCTTCCTCTCCGTTTG
CAGACAGCGGAAAAACCGCCGGAAACAATCATGGGAGCGAACGCGACTTT
TCTATCGAGATCCACGAACGATGGGCCGAAGACCCCGATCTCAAAATCAT
CAAATCCACCATCGAGAGGAACCCTGAAATGTTTGTCTTGAACAATCTCA
TGATGTGCGTCCAGTTCTTCGAGAATTATGACGAGGAGATCAACGACATC
AGAAAAACGTTGGTCTCGACGAGGGAGGCAGAAATGAACGCTCGTCGCCT
GCCTCAAAAGCACATTCTGATTCCTGACGTGCTGCAGGAGCACGTGGCGC
GGAGGATTGATTTTTCTTACATGTTGCCAAGCCTCGAGCATACGACGGAA
CTCCTTCAGCCAATCCGGGTTTACGTCGTCTTTGAAAACATCGAAGTTAC
TGAGGAAAGCTACGCGCCGGCTTATTCGAGCGTTAATGAGTCGATAACTT
ACAGCATGCAGCTGAAACCTAGTCCGACACACAAAGGGTACGTTCATCTC
CAGCGTCTCGAAGTGAATCCACCGAAGAAGACGGCGAGCGTCGATGACCT
GCGGATGCCTTCAGTTGTGAATGAGTCAAGGGAGGAGGTTTACAGCGACA
GTGAAAGTTTTTATGGCAACAAATTCAAGAAAAATGGTGGGAGGAGTAAA
AACGTGAATAATTCTATGAACGAAGAAAGCGTTTTCGAAGATTCTCGGTT
AGCGTCGCAGCCAAACAGTGGCGAGTTTGCAGGGAGCAATCGAGCTCGGG
AAGGCAACGGGGACGGTTCGTTGATGGAGGACAGTGCAGCGATGAGGAAG
GAGATCGAAGCGAGACGTGCCAGGATGAGGAGCCCTCAAAAACAGCATGG
GAAGTCGAAGTCGCTAAATCCAGCGATCGGAAGTCCCGGTGGCAGCACCA
GCTCCGGTTACAGATCCGGCAACTACATGGAGATCGACAGCGATTACGGC
TACGCGCAGACTTCGTACAGCAACACACCAAAGTCGTCGAAGAGTTCGTT
GGATGACGGGTTGTCGAGTATTTTATTGACGGAGTTGCCACGCCAGTGTT
TCAAGAAATTGGAGTTCCGAGGGGACGGTAAAATCTACGATGCTCGAAGG
GAGAAGAAGACGAAGATGACGACGAAGGAGCAGCGCATATGGCAGGCCTA
TCAGAGCCGGAATTACGTGATTTGGTACTTGAACAGCGCCAAATTCATGA
AATACTTTTGCCAGTTATTCACCGATCAGTTAGCGATCGGAATGGGTTTT
GATGCTGACATAAACGACAGTGCTCACGGCTCGGTTATTTACCGGGACAA
AGTGGAAGTTCTGGAGGGAACTCTGACCACGAAGCTAGAGACGTTCGAGA
TTGTTCCCTGCGTGAGTTCGCAGTGGCCTCAGTGTGCTCAAGAGTGGCTC
GACAGGCCGAGAAATTCCTGGCCCCAACACGAGGTTGTCGAGAGAATCAG
GAAATTTGGTTGTCACATAATGCCCGAGAGCGCGATCGATGACAAAGGGA
CGAGCCATTTCCATGACCTCGAGTGGAAATTGATATTTCCAGCTGCCGAG
CGATTCCTGGAGACCTGTTTGAGCCATTCGCAGGCCAGAGTTTACTTGAT
CGGCCTCATGCTTCACAAGACGTACATAAGACCGAACGATTCGATATTCG
GACTGACCGCAGCGCACATAAAGAACAGTCTCTTTTGGCTCATCGAGGAG
GATGATCGAGCTACGAAATGGATGGAGAGCAGAACGGGCGAGGCCTTGAT
GCGACTGCTCAAGTCTCTGTACCGAGCCATCAGCCAGGACGAGCCGAATC
TTCCAGATTTTTTCATCAAAGGGAAAAATCTCTTTCAAGAAAAGTCTTAT
CTCCTCAGAACGCAGAAGCAGCTCAAGAGGATCATCGAGAATCCTGTCAT
GTACGTCTTCCACGCCCTGGAGAACATGATGCACAGTCGAAAGTTCTTTC
CACGTTTAGATTACGAGGAATTGTTGAAGATACTCACGGCTGATATTCTC
ATCCTGATCAATCCAGTTCTGGCACCAAGAAGCCTCAAATCCGTTAGCGT
CCCCAGCGCTGAAAAGGACTACGATCATGTAACCGGCTTTTGGGACGACG
TCAAGAGGAAGGTCCACGACAAGCCAAAAAGTTACGTGAAAAAACCAGCG
CGCAACAGGAGCTTGATAAATCCTCGCAAGTCCCAAGATCAAGTTATTGA
AATACCGATGCGGTGTGCCAGCATGGAGCCTCGAAGGCTGTCAGCCCTCC
TCGATTTCTTCATCAAACACTTCATCAAAATGGCAGAATATTGTCACGCG
TACAGTGCCATGCCCCAGAAAACGGCGTACATCGAACAAGCCGAGAGACT
GTCCGTTCTCCTTTCGGAGCACCCTTCTCACAAGCACGTTGCGAAGGAGC
ACATTGAAAAAATTTGCTCGTTGAAGAGGCGAGTAGCAAACGCGAGAACG
CACGGTGCGCCACCGGAAACGCCACGCCGGAATCCCGACATGCCGATTTT
CACGAGACCGATGAACGATCCGTCGGGAAGCAACGAACTTCGAGAAGAAA
ATACGCTTCCGGCTGAGTCTGATGAAGAACCGGAGGGACGAACGAAAGCT
CAGACAACGAAGGCTGTAATACACGGGAACGATATCGATCGATCGAAGAT
CCTTGATTCTCCACCTTCCAATAGTGACACAACGATCAGGGAAGCTGGCA
GATCGAAGAGGACCGCTCGCGTCGTTTCACTCTCCGAGGAACCGGAAGAA
TCGTTTTTAACGGAAACCACTTATATTTAA
back to top

protein sequence of g17087.t1

>g17087.t1-PA ID=g17087.t1-PA|Name=g17087.t1|organism=Venturia canescens|type=polypeptide|length=959bp
MTDSFLNLDKLAMGNAKSKRKGPLSRSKASSPFADSGKTAGNNHGSERDF
SIEIHERWAEDPDLKIIKSTIERNPEMFVLNNLMMCVQFFENYDEEINDI
RKTLVSTREAEMNARRLPQKHILIPDVLQEHVARRIDFSYMLPSLEHTTE
LLQPIRVYVVFENIEVTEESYAPAYSSVNESITYSMQLKPSPTHKGYVHL
QRLEVNPPKKTASVDDLRMPSVVNESREEVYSDSESFYGNKFKKNGGRSK
NVNNSMNEESVFEDSRLASQPNSGEFAGSNRAREGNGDGSLMEDSAAMRK
EIEARRARMRSPQKQHGKSKSLNPAIGSPGGSTSSGYRSGNYMEIDSDYG
YAQTSYSNTPKSSKSSLDDGLSSILLTELPRQCFKKLEFRGDGKIYDARR
EKKTKMTTKEQRIWQAYQSRNYVIWYLNSAKFMKYFCQLFTDQLAIGMGF
DADINDSAHGSVIYRDKVEVLEGTLTTKLETFEIVPCVSSQWPQCAQEWL
DRPRNSWPQHEVVERIRKFGCHIMPESAIDDKGTSHFHDLEWKLIFPAAE
RFLETCLSHSQARVYLIGLMLHKTYIRPNDSIFGLTAAHIKNSLFWLIEE
DDRATKWMESRTGEALMRLLKSLYRAISQDEPNLPDFFIKGKNLFQEKSY
LLRTQKQLKRIIENPVMYVFHALENMMHSRKFFPRLDYEELLKILTADIL
ILINPVLAPRSLKSVSVPSAEKDYDHVTGFWDDVKRKVHDKPKSYVKKPA
RNRSLINPRKSQDQVIEIPMRCASMEPRRLSALLDFFIKHFIKMAEYCHA
YSAMPQKTAYIEQAERLSVLLSEHPSHKHVAKEHIEKICSLKRRVANART
HGAPPETPRRNPDMPIFTRPMNDPSGSNELREENTLPAESDEEPEGRTKA
QTTKAVIHGNDIDRSKILDSPPSNSDTTIREAGRSKRTARVVSLSEEPEE
SFLTETTYI
back to top

mRNA from alignment at scaffold_1295:22881..26874-

Legend: polypeptideCDSexonstart_codonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g17087.t1 ID=g17087.t1|Name=g17087.t1|organism=Venturia canescens|type=mRNA|length=3994bp|location=Sequence derived from alignment at scaffold_1295:22881..26874- (Venturia canescens)
ATGACCGACAGCTTTCTGAACCTCGACAAATTGGCAATGGGCAACGCTAA ATCGAAACGGAAAGGTCCCCTCAGCAGGAGCAAAGCTTCCTCTCCGTTTG CAGACAGCGGAAAAACCGCCGGAAACAATCATGGGAGCGAACGCGACTTT TCTATCGAGATCCACGAACGATGGGCCGAAGACCCCGATCTCAAAATCAT CAAATCCACCATCGAGAGGAACCCTGAAATGTTTGTCTTGAACAATCTCA TGATGTGCGTCCAGTTCTTCGAGAATTATGACGAGTAAGCATCGAGCAGG ACTTTTGTTAAATTAGCAATCCCCAAATCTAAAAACCTCTAATTCCTTGC TGATTTTAGAGAACGATAAACGAATGAGTGACACTTTTATTTTACGAGAT TAGGCTATTTTCGCGAGGCTCCTAAGTAGGTCGCGTTCTGACCACCCGAT TGAAATACCGTTGTTTCGACGCACTCGACACCTGAAATAGTCTATCGGAA GCTTGAAAAATCTCTCAATTGAAGTAGAAAAATAAATTTTCTGTGAAGCA AATATTTTGTTTAACTTTTTAAATTCATTTAAATCGAAATGTCGAAGACG TTGACAAAAATTAATTCCGAGCTCGTGATTGATACAATTAGAGAAAACTC TTCGAATAACAAGTAAATTGAAAAATGATTTCGAGGCAGGCAGCATGGAA TCGTTATCTTTGAATTCTTCGGTCGAGTGCTCGGACTGGATGTAATCTGA GGAGCTAATCTTCATTTCGAATAGATGTCTAATCAATTATAAATAGTGGC GACGTACCGAAAACCGTGGATTTCAAAATGGTAGCCAAAAAGCTCAAAAA CTTTGCTTCGATTTTCCTGAACGAATGATTTTTGTAGGGAGATCAACGAC ATCAGAAAAACGTTGGTCTCGACGAGGGAGGCAGAAATGAACGCTCGTCG CCTGCCTCAAAAGCACATTCTGATTCCTGACGTGCTGCAGGAGCACGTGG CGCGGAGGATTGATTTTTCTTACATGTTGCCAAGCCTCGAGCATACGACG GAACTCCTTCAGCCAATCCGGGTTTACGTCGTCTTTGAAAACATCGAAGT TACTGAGGAAAGCTACGCGCCGGCTTATTCGAGCGTTAATGAGTCGATAA CTTACAGCATGCAGCTGAAACCTAGTCCGACACACAAAGGTGAGTCGAAG AATCAAAAACTCAAGACTGCCGTGTGAAGATCGATTGGCAATTTCGCAGA AACGAAATTCAAAGAGTACAAAAACATTTTTTCAACGTGAGAAACACTAA TTCGAAGTTTTTCAGCCGCGTACAATGTGGAGATCGTAATTATCGCCCGT AACAAAAATCCCAATTTCTTTATCCATTTTCATATATTTTCGTTCCACAC GAACCTATAGAAACCCAAAAAAATTACGAAATTCTATATTTTTGGCGAGT TTGAAGTGAAAAAACGCTCCCAAAGAAGAAGAAGAAGAATATCAACGTGC TCTAAACATAGAATTTCACAATTTTTTAATAAGTTTGTCCTAAAATCCGT CTGTCCTAAAAACATTGCCGAAAAGAATCGATTTTTTTGACTTTCTAAAG CCCCCCCTTAATTTTCTCAGGGTACGTTCATCTCCAGCGTCTCGAAGTGA ATCCACCGAAGAAGACGGCGAGCGTCGATGACCTGCGGATGCCTTCAGTT GTGAATGAGTCAAGGGAGGAGGTTTACAGCGACAGTGAAAGTTTTTATGG CAACAAATTCAAGAAAAATGGTGGGAGGAGTAAAAACGTGAATAATTCTA TGAACGAAGAAAGCGTTTTCGAAGATTCTCGGTTAGCGTCGCAGCCAAAC AGTGGCGAGTTTGCAGGGAGCAATCGAGCTCGGGAAGGCAACGGGGACGG TTCGTTGATGGAGGACAGTGCAGCGATGAGGAAGGAGATCGAAGCGAGAC GTGCCAGGATGAGGAGCCCTCAAAAACAGCATGGGAAGTCGAAGTCGCTA AATCCAGCGATCGGAAGTCCCGGTGGCAGCACCAGCTCCGGTTACAGATC CGGCAACTACATGGAGATCGACAGCGATTACGGCTACGCGCAGACTTCGT ACAGCAACACACCAAAGTCGTCGAAGAGTTCGTTGGATGACGGGTTGTCG AGTATTTTATTGACGGAGTTGCCACGCCAGTGTTTCAAGAAATTGGAGTT CCGAGGGGACGGTAAAATCTACGATGCTCGAAGGGAGAAGAAGACGAAGA TGACGACGAAGGAGCAGCGCATATGGCAGGCCTATCAGAGCCGGAATTAC GTGATTTGGTACTTGAACAGCGCCAAATTCATGAAATACTTTTGCCAGTT ATTCACCGATCAGTTAGCGATCGGAATGGGTTTTGATGCTGACATAAACG ACAGTGCTCACGGCTCGGTTATTTACCGGGACAAAGTGGAAGTTCTGGAG GGAACTCTGACCACGAAGCTAGAGACGTTCGAGATTGTTCCCTGCGTGAG TTCGCAGTGGCCTCAGTGTGCTCAAGAGTGGCTCGACAGGCCGAGAAATT CCTGGCCCCAACACGAGGTTGTCGAGAGAATCAGGAAATTTGGTTGTCAC ATAATGCCCGAGAGCGCGATCGATGACAAAGGGACGAGCCATTTCCATGA CCTCGAGTGGAAATTGATATTTCCAGCTGCCGAGCGATTCCTGGAGACCT GTTTGAGCCATTCGCAGGCCAGAGTTTACTTGATCGGCCTCATGCTTCAC AAGACGTACATAAGACCGAACGATTCGATATTCGGACTGACCGCAGCGCA CATAAAGAACAGTCTCTTTTGGCTCATCGAGGAGGATGATCGAGCTACGA AATGGATGGAGAGCAGAACGGGCGAGGCCTTGATGCGACTGCTCAAGTCT CTGTACCGAGCCATCAGCCAGGACGAGCCGAATCTTCCAGATTTTTTCAT CAAAGGGAAAAATCTCTTTCAAGAAAAGTCTTATCTCCTCAGAACGCAGA AGCAGCTCAAGAGGATCATCGAGAATCCTGTCATGTACGTCTTCCACGCC CTGGAGAACATGATGCACAGTCGAAAGTTCTTTCCACGTTTAGATTACGA GGAATTGTTGAAGATACTCACGGCTGATATTCTCATCCTGATCAATCCAG TTCTGGCACCAAGAAGCCTCAAATCCGTTAGCGTCCCCAGCGCTGAAAAG GACTACGATCATGTAACCGGCTTTTGGGACGACGTCAAGAGGAAGGTCCA CGACAAGCCAAAAAGTTACGTGAAAAAACCAGCGCGCAACAGGAGCTTGA TAAATCCTCGCAAGTCCCAAGATCAAGTTATTGAAATACCGGTGAGTCGT GCGTTTTCTTTTATTTAAGTAAGAAAAAAGAAGATAAATTTCTATCAAAA GTCGTTTTTGCCTGTGAACAGATGCGGTGTGCCAGCATGGAGCCTCGAAG GCTGTCAGCCCTCCTCGATTTCTTCATCAAACACTTCATCAAAATGGCAG AATATTGTCACGCGTACAGTGCCATGCCCCAGAAAACGGCGTACATCGAA CAAGCCGAGAGACTGTCCGTTCTCCTTTCGGAGCACCCTTCTCACAAGCA CGTTGCGAAGGAGCACATTGAAAAAATTTGCTCGTTGAAGAGGCGAGTAG CAAACGCGAGAACGCACGGTGCGCCACCGGAAACGCCACGCCGGAATCCC GACATGCCGATTTTCACGAGACCGATGAACGATCCGTCGGGAAGCAACGA ACTTCGAGAAGAAAATACGCTTCCGGCTGAGTCTGATGAAGAACCGGAGG GACGAACGAAAGCTCAGACAACGAAGGCTGTAATACACGGGAACGATATC GATCGATCGAAGATCCTTGATTCTCCACCTTCCAATAGTGACACAACGAT CAGGGAAGCTGGCAGATCGAAGAGGACCGCTCGCGTCGTTTCACTCTCCG AGGAACCGGAAGAATCGTTTTTAACGGAAACCACTTATATTTAA
back to top

Coding sequence (CDS) from alignment at scaffold_1295:22881..26874-

>g17087.t1 ID=g17087.t1|Name=g17087.t1|organism=Venturia canescens|type=CDS|length=2880bp|location=Sequence derived from alignment at scaffold_1295:22881..26874- (Venturia canescens)
ATGACCGACAGCTTTCTGAACCTCGACAAATTGGCAATGGGCAACGCTAA
ATCGAAACGGAAAGGTCCCCTCAGCAGGAGCAAAGCTTCCTCTCCGTTTG
CAGACAGCGGAAAAACCGCCGGAAACAATCATGGGAGCGAACGCGACTTT
TCTATCGAGATCCACGAACGATGGGCCGAAGACCCCGATCTCAAAATCAT
CAAATCCACCATCGAGAGGAACCCTGAAATGTTTGTCTTGAACAATCTCA
TGATGTGCGTCCAGTTCTTCGAGAATTATGACGAGGAGATCAACGACATC
AGAAAAACGTTGGTCTCGACGAGGGAGGCAGAAATGAACGCTCGTCGCCT
GCCTCAAAAGCACATTCTGATTCCTGACGTGCTGCAGGAGCACGTGGCGC
GGAGGATTGATTTTTCTTACATGTTGCCAAGCCTCGAGCATACGACGGAA
CTCCTTCAGCCAATCCGGGTTTACGTCGTCTTTGAAAACATCGAAGTTAC
TGAGGAAAGCTACGCGCCGGCTTATTCGAGCGTTAATGAGTCGATAACTT
ACAGCATGCAGCTGAAACCTAGTCCGACACACAAAGGGTACGTTCATCTC
CAGCGTCTCGAAGTGAATCCACCGAAGAAGACGGCGAGCGTCGATGACCT
GCGGATGCCTTCAGTTGTGAATGAGTCAAGGGAGGAGGTTTACAGCGACA
GTGAAAGTTTTTATGGCAACAAATTCAAGAAAAATGGTGGGAGGAGTAAA
AACGTGAATAATTCTATGAACGAAGAAAGCGTTTTCGAAGATTCTCGGTT
AGCGTCGCAGCCAAACAGTGGCGAGTTTGCAGGGAGCAATCGAGCTCGGG
AAGGCAACGGGGACGGTTCGTTGATGGAGGACAGTGCAGCGATGAGGAAG
GAGATCGAAGCGAGACGTGCCAGGATGAGGAGCCCTCAAAAACAGCATGG
GAAGTCGAAGTCGCTAAATCCAGCGATCGGAAGTCCCGGTGGCAGCACCA
GCTCCGGTTACAGATCCGGCAACTACATGGAGATCGACAGCGATTACGGC
TACGCGCAGACTTCGTACAGCAACACACCAAAGTCGTCGAAGAGTTCGTT
GGATGACGGGTTGTCGAGTATTTTATTGACGGAGTTGCCACGCCAGTGTT
TCAAGAAATTGGAGTTCCGAGGGGACGGTAAAATCTACGATGCTCGAAGG
GAGAAGAAGACGAAGATGACGACGAAGGAGCAGCGCATATGGCAGGCCTA
TCAGAGCCGGAATTACGTGATTTGGTACTTGAACAGCGCCAAATTCATGA
AATACTTTTGCCAGTTATTCACCGATCAGTTAGCGATCGGAATGGGTTTT
GATGCTGACATAAACGACAGTGCTCACGGCTCGGTTATTTACCGGGACAA
AGTGGAAGTTCTGGAGGGAACTCTGACCACGAAGCTAGAGACGTTCGAGA
TTGTTCCCTGCGTGAGTTCGCAGTGGCCTCAGTGTGCTCAAGAGTGGCTC
GACAGGCCGAGAAATTCCTGGCCCCAACACGAGGTTGTCGAGAGAATCAG
GAAATTTGGTTGTCACATAATGCCCGAGAGCGCGATCGATGACAAAGGGA
CGAGCCATTTCCATGACCTCGAGTGGAAATTGATATTTCCAGCTGCCGAG
CGATTCCTGGAGACCTGTTTGAGCCATTCGCAGGCCAGAGTTTACTTGAT
CGGCCTCATGCTTCACAAGACGTACATAAGACCGAACGATTCGATATTCG
GACTGACCGCAGCGCACATAAAGAACAGTCTCTTTTGGCTCATCGAGGAG
GATGATCGAGCTACGAAATGGATGGAGAGCAGAACGGGCGAGGCCTTGAT
GCGACTGCTCAAGTCTCTGTACCGAGCCATCAGCCAGGACGAGCCGAATC
TTCCAGATTTTTTCATCAAAGGGAAAAATCTCTTTCAAGAAAAGTCTTAT
CTCCTCAGAACGCAGAAGCAGCTCAAGAGGATCATCGAGAATCCTGTCAT
GTACGTCTTCCACGCCCTGGAGAACATGATGCACAGTCGAAAGTTCTTTC
CACGTTTAGATTACGAGGAATTGTTGAAGATACTCACGGCTGATATTCTC
ATCCTGATCAATCCAGTTCTGGCACCAAGAAGCCTCAAATCCGTTAGCGT
CCCCAGCGCTGAAAAGGACTACGATCATGTAACCGGCTTTTGGGACGACG
TCAAGAGGAAGGTCCACGACAAGCCAAAAAGTTACGTGAAAAAACCAGCG
CGCAACAGGAGCTTGATAAATCCTCGCAAGTCCCAAGATCAAGTTATTGA
AATACCGATGCGGTGTGCCAGCATGGAGCCTCGAAGGCTGTCAGCCCTCC
TCGATTTCTTCATCAAACACTTCATCAAAATGGCAGAATATTGTCACGCG
TACAGTGCCATGCCCCAGAAAACGGCGTACATCGAACAAGCCGAGAGACT
GTCCGTTCTCCTTTCGGAGCACCCTTCTCACAAGCACGTTGCGAAGGAGC
ACATTGAAAAAATTTGCTCGTTGAAGAGGCGAGTAGCAAACGCGAGAACG
CACGGTGCGCCACCGGAAACGCCACGCCGGAATCCCGACATGCCGATTTT
CACGAGACCGATGAACGATCCGTCGGGAAGCAACGAACTTCGAGAAGAAA
ATACGCTTCCGGCTGAGTCTGATGAAGAACCGGAGGGACGAACGAAAGCT
CAGACAACGAAGGCTGTAATACACGGGAACGATATCGATCGATCGAAGAT
CCTTGATTCTCCACCTTCCAATAGTGACACAACGATCAGGGAAGCTGGCA
GATCGAAGAGGACCGCTCGCGTCGTTTCACTCTCCGAGGAACCGGAAGAA
TCGTTTTTAACGGAAACCACTTATATTTAA
back to top