g17088.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg17088.t1
Unique Nameg17088.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1295contigscaffold_1295:26943..35389 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g17088g17088Venturia canescensgenescaffold_1295 26943..35389 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17088.t1g17088.t1-PAVenturia canescenspolypeptidescaffold_1295 26943..35389 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17088.t1-start_codong17088.t1-start_codonVenturia canescensstart_codonscaffold_1295 26943..26945 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17088.t1-CDSg17088.t1-CDS-1Venturia canescensCDSscaffold_1295 26943..27281 +
g17088.t1-CDSg17088.t1-CDS-2Venturia canescensCDSscaffold_1295 29471..29722 +
g17088.t1-CDSg17088.t1-CDS-3Venturia canescensCDSscaffold_1295 29921..30172 +
g17088.t1-CDSg17088.t1-CDS-4Venturia canescensCDSscaffold_1295 30327..30491 +
g17088.t1-CDSg17088.t1-CDS-5Venturia canescensCDSscaffold_1295 31215..31548 +
g17088.t1-CDSg17088.t1-CDS-6Venturia canescensCDSscaffold_1295 31616..31731 +
g17088.t1-CDSg17088.t1-CDS-7Venturia canescensCDSscaffold_1295 32650..33049 +
g17088.t1-CDSg17088.t1-CDS-8Venturia canescensCDSscaffold_1295 33127..33467 +
g17088.t1-CDSg17088.t1-CDS-9Venturia canescensCDSscaffold_1295 33871..34012 +
g17088.t1-CDSg17088.t1-CDS-10Venturia canescensCDSscaffold_1295 34093..34163 +
g17088.t1-CDSg17088.t1-CDS-11Venturia canescensCDSscaffold_1295 34433..34611 +
g17088.t1-CDSg17088.t1-CDS-12Venturia canescensCDSscaffold_1295 34753..34957 +
g17088.t1-CDSg17088.t1-CDS-13Venturia canescensCDSscaffold_1295 35192..35389 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17088.t1-exong17088.t1-exon-1Venturia canescensexonscaffold_1295 26943..27281 +
g17088.t1-exong17088.t1-exon-2Venturia canescensexonscaffold_1295 29471..29722 +
g17088.t1-exong17088.t1-exon-3Venturia canescensexonscaffold_1295 29921..30172 +
g17088.t1-exong17088.t1-exon-4Venturia canescensexonscaffold_1295 30327..30491 +
g17088.t1-exong17088.t1-exon-5Venturia canescensexonscaffold_1295 31215..31548 +
g17088.t1-exong17088.t1-exon-6Venturia canescensexonscaffold_1295 31616..31731 +
g17088.t1-exong17088.t1-exon-7Venturia canescensexonscaffold_1295 32650..33049 +
g17088.t1-exong17088.t1-exon-8Venturia canescensexonscaffold_1295 33127..33467 +
g17088.t1-exong17088.t1-exon-9Venturia canescensexonscaffold_1295 33871..34012 +
g17088.t1-exong17088.t1-exon-10Venturia canescensexonscaffold_1295 34093..34163 +
g17088.t1-exong17088.t1-exon-11Venturia canescensexonscaffold_1295 34433..34611 +
g17088.t1-exong17088.t1-exon-12Venturia canescensexonscaffold_1295 34753..34957 +
g17088.t1-exong17088.t1-exon-13Venturia canescensexonscaffold_1295 35192..35389 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17088.t1-introng17088.t1-intronVenturia canescensintronscaffold_1295 34958..35191 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17088.t1-stop_codong17088.t1-stop_codonVenturia canescensstop_codonscaffold_1295 35387..35389 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g17088.t1 ID=g17088.t1|Name=g17088.t1|organism=Venturia canescens|type=mRNA|length=2994bp|location=Sequence derived from alignment at scaffold_1295:26943..35389+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGATCGTCTTCCCGGTGACGTTCGCGTCTCGCCTCGACGGTATCTCGTC
GAATCGACGATATCTTTTTATTCCAAGGATCATAAAGACCGCTCAGGGTT
TACTGGCCTCGGTGCTGGCGGCACGAGGCTCCCATCTCGGTTCAATGCTT
TTGCAGACGAGTTCGAGCGGGCCCGGGATGAAGCCTAGAGCCACGGAAGT
CCGCAATTCAATTACGAGCACTCACACCAGCTGGATAATCGTGTTGCAAC
GAAATTTGAACTACTTTGGTCCGAAAATTGGCATAATTCTTGGAGAATTC
AAATCGCAGTTAAATCACTCGAACCAAGCTCCGACGGTGGTTGAGCCAGT
AGAATGGACGTTCGAGAACATCGAAAATGTGAACGAAGATTCGAGTACCA
ACGAACTTCGGCACCTCGCTGATTTCCTGTCGAAAAAGCACTTCGATCTG
GTCATTAATCTTCCGATGCGAAACGGAGGAGCGAGAAGGGTATCGAATTT
CATGACGCATGGTTATCGTACAAGGAGGCTTGCCGTTGATTATTCCGTGC
CACTTGTGACTGACGTCAAATGCGCCAAACTTTTGGTCGATGCGATAAGC
AAGCTGGGAGGCAAAACGCCTCCGATGAAAACGCACGCCGATTGCATGTC
TTCGCGAAAGCTCCTCAAACTGCCCGGCTTCATCGACGTCCACGTTCATA
CTCGCGATCCTGGAGCCACCGAGAAAGAGGATTATGCGTCTTGCACAGCA
GCAGCTCTCGCCGGAGGTGTTACAGCGATATTCGCGATGCCGAACACGAA
TCCTGCTGTGGTCGATAGTCAGTCGTTTGCTCAAGCGAAAGAGCGAGCCG
TAGCTGGTGCGAGGTGCGATTACGCAATTTTCGTCGGTGCATCATCGGAC
AATTGGAACGTAGCTCCGGAGTTAGCCCCCCTGGCTGCGGGCCTTAAGAT
GTATTTGAACGAGACATTCACGACTCTGCGACTGAACGACGTCAGTGTTT
GGATGAAGCACCTCGAAACGTGGCCGAAAAAATACCCGGTGTGCGTTCAC
GCCGAGGGTCAAACGACCGGAAACGTGATTCTCCTGGCGAGCTGTCACAA
CCGATCGGTGCACGTGTGTCACGTGGCACGAAAGGAAGAAATATTGATAA
TTCGAGCAGCGAAAGAAAAGGGTCTTGCTGTAACCTGCGAAGTTTCGCCA
CATCACCTTTTCCTGAATCAAACCGACCTCGAGAGAATCGGTTACGGGAA
AGGTCAAGTGCGACCGATTTTAGGAACGCCCGAAGACCAGCAGGCGCTTT
GGGACAACATGGACATCATCGACTGCTTCGCGACGGACCACGCACCGCAC
ACCGTCGAAGAGAAAACCAGCGAGAAACCTCCCCCCGGTTTTCCCGGACT
CGAGACCGTTCTGCCGCTGCTTCTGAACGCCGTTCACGAAGGGAAATTGT
CACTGAAGGATTTGGTCGACAAATTCCACAAAAATCCGAAACGGATTTTC
AGCCTACCGGAGCAACCGAATACCTACGTCGAGGTGGATTTGGAGAACGA
ATGGGTGATACCGGAGGCTCTGCCGTTCACGAAGTCGAAGTGGACGCCGT
TCGCTGGAACGAAGGTCAGGGGCTCGGTTCACAGGGTCGTGCTCAGGGGC
GAAGTCGCTTTCATCGACGGCCAGGTTCTCGTTAATCCAGGTTTCGGTCA
GGATCTGAGGGAGGTTCAAGCGAATTTGAGCAGCCAAACGATTCTTCTTC
CCTTGCCATCGGTCGACGTCAGCGCCGTTCCGCTTTCCGTTTTCGAGGGA
CTCATTTCGCCAAATTATGAAAAAAGACCGCCGGATGCAGCCCACGAAGA
GCACAACGAATTGCACAACAATTTGCTCCAAATCGGAACGAAGCCGGCTT
CCCACCCGTCTCCGGACGTCGATCCACGAAATTATTCCGCCAAACTCGCA
GCTCTTCCGAACTGCCTTTCTCCCGTGTCGTCGAGCATCGTCACGGCTTA
CAAAACCGAAAACAGTGCTCATCTCTGCGCCCCGGTCGCTCCGCCACTTC
CGCGGATTCATCCCAGTCGCAGCATCTACGGAAGGCACATTCTCTCCGTT
GACATGTTCAGCAAGGAACAGTTACACGATATGTTCAACCTCGCTCACAC
CTTCCGCGCTGACGTCACCAACAAGAGGCCTGTCCATCACATCTTGGCGG
GAAGAGAATTGATGTCGATATTCTTCGAGAACAGCACACGAACATCCTGC
AGTTTTACGGTCGCGATGCATCGACTCGGCGGAACCGTCACGGTCGTCGA
CGTGTCTAAGTCTTCGATCAAAAAGGGAGAAACTCTCGAAGATACGATAG
CAGTGATGGCCAGTTATGGGGATGCTGTGGTCGTGCGACACCCGGAGCCA
GGTGCAGTCGAACGCGCAGCTCAACACTGTCGAGTCCCGATGATAAACGG
AGGTGACGGAGTTGGCGAACACCCGACCCAAGCCCTCCTCGATATTTTTA
CAATCAGAGAAGAGATCGGCACCGTGAATGGTTTGACGATAACGATGGTC
GGAGATCTGAAGCACGGAAGAACGGTTCATTCGCTCGCGAGATTGCTGAC
TCTGTACAACGTTCAATTGCGATACGTCAGCCCCCCTGAACTCGGAATGC
CTGATCACATAATCAGTTACGTAACCAAGCGCGGAATACGACAGAAAAAG
ATTGCTAGCCTCGAAGAGGTTCTTCCTGAAACGGACGTTTTGTACATGAC
CCGAATTCAACGCGAGCGATTCACCACTCAAGAAGAATATGACAAGGCCT
GCGGTCACTTCGTAGTGACACCTCAGCTCATGACACGAGCCAAAAGGAAA
ATGGTCGTGATGCATCCTTTGCCAAGAGTATTTGAAATAAGTCCTGAATT
CGACACGGACCCAAGAGCCGCCTATTTCCGGCAGGCCGAGTACGGCGTGT
ACGTCAGAATGGCGCTTCTTTTCATGGTGCTTGGAAACGCCTGA
back to top

protein sequence of g17088.t1

>g17088.t1-PA ID=g17088.t1-PA|Name=g17088.t1|organism=Venturia canescens|type=polypeptide|length=997bp
MIVFPVTFASRLDGISSNRRYLFIPRIIKTAQGLLASVLAARGSHLGSML
LQTSSSGPGMKPRATEVRNSITSTHTSWIIVLQRNLNYFGPKIGIILGEF
KSQLNHSNQAPTVVEPVEWTFENIENVNEDSSTNELRHLADFLSKKHFDL
VINLPMRNGGARRVSNFMTHGYRTRRLAVDYSVPLVTDVKCAKLLVDAIS
KLGGKTPPMKTHADCMSSRKLLKLPGFIDVHVHTRDPGATEKEDYASCTA
AALAGGVTAIFAMPNTNPAVVDSQSFAQAKERAVAGARCDYAIFVGASSD
NWNVAPELAPLAAGLKMYLNETFTTLRLNDVSVWMKHLETWPKKYPVCVH
AEGQTTGNVILLASCHNRSVHVCHVARKEEILIIRAAKEKGLAVTCEVSP
HHLFLNQTDLERIGYGKGQVRPILGTPEDQQALWDNMDIIDCFATDHAPH
TVEEKTSEKPPPGFPGLETVLPLLLNAVHEGKLSLKDLVDKFHKNPKRIF
SLPEQPNTYVEVDLENEWVIPEALPFTKSKWTPFAGTKVRGSVHRVVLRG
EVAFIDGQVLVNPGFGQDLREVQANLSSQTILLPLPSVDVSAVPLSVFEG
LISPNYEKRPPDAAHEEHNELHNNLLQIGTKPASHPSPDVDPRNYSAKLA
ALPNCLSPVSSSIVTAYKTENSAHLCAPVAPPLPRIHPSRSIYGRHILSV
DMFSKEQLHDMFNLAHTFRADVTNKRPVHHILAGRELMSIFFENSTRTSC
SFTVAMHRLGGTVTVVDVSKSSIKKGETLEDTIAVMASYGDAVVVRHPEP
GAVERAAQHCRVPMINGGDGVGEHPTQALLDIFTIREEIGTVNGLTITMV
GDLKHGRTVHSLARLLTLYNVQLRYVSPPELGMPDHIISYVTKRGIRQKK
IASLEEVLPETDVLYMTRIQRERFTTQEEYDKACGHFVVTPQLMTRAKRK
MVVMHPLPRVFEISPEFDTDPRAAYFRQAEYGVYVRMALLFMVLGNA
back to top

mRNA from alignment at scaffold_1295:26943..35389+

Legend: polypeptidestart_codonCDSexonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g17088.t1 ID=g17088.t1|Name=g17088.t1|organism=Venturia canescens|type=mRNA|length=8447bp|location=Sequence derived from alignment at scaffold_1295:26943..35389+ (Venturia canescens)
ATGATCGTCTTCCCGGTGACGTTCGCGTCTCGCCTCGACGGTATCTCGTC GAATCGACGATATCTTTTTATTCCAAGGATCATAAAGACCGCTCAGGGTT TACTGGCCTCGGTGCTGGCGGCACGAGGCTCCCATCTCGGTTCAATGCTT TTGCAGACGAGTTCGAGCGGGCCCGGGATGAAGCCTAGAGCCACGGAAGT CCGCAATTCAATTACGAGCACTCACACCAGCTGGATAATCGTGTTGCAAC GAAATTTGAACTACTTTGGTCCGAAAATTGGCATAATTCTTGGAGAATTC AAATCGCAGTTAAATCACTCGAACCAAGCTCCGACGGTGGTCAAAAAAAT TGGACAAAAAAGTTCAGACCCAAAGTAGAACAAATCCGAATAAACTGCGT CAAAATCGACCTCCGAGTACATCCGGAACTAAAATTAATTCGGAAAAATA GAGGATCCAAAAATCCAAATTGCTCCGTCCAGAATTCCGAAAGTTTCGCA ATCAACGCTCAGGAATTGCAATTAAATTTCAACCCCCTTTTGCCTCGCTA ATTCCACATTATTTCCCTCCGAATTATTTTGAACTTGCCACTTTCTCACG TCGCCCACTTCCCCCTGATAACGTCCGACTGACACGATCGAAATTCAAAG ACGCCAGAACAGCCTCGATCTCGCGATCCACCAGCGATAAAAGCCTATCT CGTTATCAAGCGACGAACGAACGCTTTCGATTCGACACTCCGGCTATCGG GTTATCGATAATAAACTCATCGTCAGCACCAACACCGCCAACCACGCGAA TTTTTCATTATTTTCAAAATACGTTCACCTCCGTTGCCTCTTTGCTTGCG AAACCGGAAATTATACTAAATTGAGCGACTCACGATGCCAAGACTTCTGA AGTCGCGTCGATAAATCACTGAGAATCGTTCGACCGCCGGCTTTCTGATT GCGTGACGCTTTACAGAATCTCTCGATACACGGATCGAGATAATGGACAG AAAAAGCGATGATTCCCTGATACAAGGTCGTCTAACTCATTTCCGGATTC CACAAGGTCCTTGTCAGTGCTTCACCCGACCTAGACCTTAATCGAATCTT TGATGTCCGAGACACATCGTTGTACGGTGACTTCAGAAGGATCGTGAATC CAAAAGTCCTTAATTAATCGGTTTCGATCGAAACTAAGCTCGCCAGTCGG AATGAAATCCTGGGAAAAGGAGAATCAAACTTTGGGCCAGTGAATTTTAG CTCTTGAAAAAATCAACGCTGCGAAAGCTGAGCTTGGATTTGTGTACTTT CACTCGTGTATTCTAATCAATTCTCTTAGATAAGCGGGTAGCCGCAGATA TGCCATTGCGATTTTATTGCTCGGCCCTAAAGTACACACATTTATTGGAG CTCCTGAAATGACGTGCACTTGAAGATAAAATTAGACATTGTTTTGGGGT TGGCAACCGAATTTTTTTCACGAAATATCATTTTAGATATTATTTAGTAG GAACGAGGTTCGATAGTTTTTGTCTTTTTTCAATGGGTGGGAATAAAATG TTGGAATGACTTAAAATTTCGAACAGCTAAAATCTCGAGTTTATAAACTT CGAATGATAATATGGAGACAGATGAATTCGACTAGAGCTTTGAATGTTGA AAATAAATAAAGTAGAAAATTCAAAGTTCGAAGCACGTTCACATCGAAAA TGGAATGTAACAATCCCCCATAGAACGACGACTAAAATATCGATTTTCCG AAAATTCGACTATCACTCTGTCGATTCATAAATTACTACAACCAGCAATA CTGTGAATATTGACTATTTCGAAAATATAATAAGGAAAGACCGAATATTA CTGAGGTTCAAATACCGAAAGACCAAAATGGCGTTCACGAAAAATTCATT TTCGATTTTTTGCTATTCTATATTCCTGTCTGTCTGTAAAACAATTACTC TCCACCTATAATTCGAAAATATGAACTTCTGACATTCGTATGGTCTGTTA AAATTGCATTCGAAATGCAAACTATCGAAAAATATATTTTCGAGTAAACA CGAATTGAAAGAAGATGAAATATTCGATTAAACGCGTAATCTGTTAAATA ATCGATCGAGAATAAGAATTTCAAATTACCTATTTTTCCTCAATCTGATA TCACGAGTTAAAAAATTTCGAAATATCGATCGTTTTTCAATTTGGTTATT CGACATATTGAAGCCTTTCGCTAATCCCTTGGCGTTGCAGCTCGAGGAAG AGACTTGGTCGATAATAACGAGAATCTGTCGCACTTAATCAGTGAGTTGA GCCATTTATGGACAGTAGAATTTCTAACGAATTGGATTAATTCTGATGCA CTCCAATCGTCGTTAATTTTGTTTGACTTCTTTTATTTATCAACTGATTC CAGAAATTCTGAGAATATCGTAATTTTTATGCGATTTTCAAATTTTTCTC GAGCGATTTTCAAATCAGAGTCAGCCCAATAAAAATTTGTTCATCTCCAA CGATTTTGCTTTTTTTCTCCCATTTAAGGTTGAGCCAGTAGAATGGACGT TCGAGAACATCGAAAATGTGAACGAAGATTCGAGTACCAACGAACTTCGG CACCTCGCTGATTTCCTGTCGAAAAAGCACTTCGATCTGGTCATTAATCT TCCGATGCGAAACGGAGGAGCGAGAAGGGTATCGAATTTCATGACGCATG GTTATCGTACAAGGAGGCTTGCCGTTGATTATTCCGTGCCACTTGTGACT GACGTCAAATGCGCCAAACTTTTGGTCGATGTGAGTAATCGATTGACATA AATCGCAGATAATTTACTGGATGACGAGGGAAGTTGCATCGTCCACGAAA TATTCGGGTCATTAACCTTCGAAATTCGTTGTGATAAAATGAATTTTTGA GTTTGGCAACAGCGAGATTTCATTCGCCAGAACCGTCCATCTCGAGACTA AAGAATCGTCAATATTTTTGTCTAACAGGCGATAAGCAAGCTGGGAGGCA AAACGCCTCCGATGAAAACGCACGCCGATTGCATGTCTTCGCGAAAGCTC CTCAAACTGCCCGGCTTCATCGACGTCCACGTTCATACTCGCGATCCTGG AGCCACCGAGAAAGAGGATTATGCGTCTTGCACAGCAGCAGCTCTCGCCG GAGGTGTTACAGCGATATTCGCGATGCCGAACACGAATCCTGCTGTGGTC GATAGTCAGTCGTTTGCTCAAGCGAAAGAGGTGAGAAAATCCAAGAAAAT CGCGTACTCTCGGATGGCGATTTACTGAGAGAATCATCGTGGCGAAAAGT CCAAGATTTTCGTGAATTTTCAAATGTTTTCCAAGTTTTTTAACGATCTC ATTTTGTTCCCGTCCCGTTGGATCTCCCGAACAGCGAGCCGTAGCTGGTG CGAGGTGCGATTACGCAATTTTCGTCGGTGCATCATCGGACAATTGGAAC GTAGCTCCGGAGTTAGCCCCCCTGGCTGCGGGCCTTAAGATGTATTTGAA CGAGACATTCACGACTCTGCGACTGAACGACGTCAGTGTTTGGATGAAGG TAAATCGAAAGCCCTTAATAAACGATTGCTTGATTGAATAGCGAAACGGA GTTGCAGGCGGTGAGTTTTCGCTTCCTTGAGCCTGATTAATTCGGACTTA TCTCAAGGCGGAAACCACTGAAGATTATTCGATAGGGAGATAAGAACAAA GCGGTCTTAACGAGCTTGCGAACAAGTTATTATGGTAACGTAAGAAACGT CGAGTTGACGCGATGAAAGCTGCTGAGCGTTGGACCATTTTTTCGCCATC GTCGAACTTTTTAACCGGCAATTCTTCGTGGAAATCATTTTTTTCTATTT CTTAACATCTTGCCTAAGATTGGAAGCTCTCGAGATACGATGCGTTCAAT TACGTAATTCTCAAGATAAAATGGCCTTTATCCATTTTTCTCTCTGATCG AACGTTGATGAAACGTCGATTTATTGGCGGCAGCCAATCGGAGGCCACGA AAAGGGGAAGTGGGAGTGGCAGGCCACGTGCGCAGCGACCCACGAAGCGT TCTGCGCACCTCCCACTATGTGGCTCAGCGAAACTCGGTGCTGAACGCGC TCACATTTCTCGATCAACATCTCGTGAACGGTGCGCCGAGAAAAGATTGA TGCTTGAATGTTTTTTTCCAGGATTTCAAGTTCTACTGGCCGAAGCTTGT TACGATTCGCTGTAGATAATTAAAAGATGATAAAATTTTGTTTTTTGTGG ATAAAAACCTACTGAATTTCAGCACCTCGAAACGTGGCCGAAAAAATACC CGGTGTGCGTTCACGCCGAGGGTCAAACGACCGGAAACGTGATTCTCCTG GCGAGCTGTCACAACCGATCGGTGCACGTGTGTCACGTGGCACGAAAGGA AGAAATATTGATAATTCGAGCAGCGAAAGAAAAGGGTCTTGCTGTAACCT GCGAAGTTTCGCCACATCACCTTTTCCTGAATCAAACCGACCTCGAGAGA ATCGGTTACGGGAAAGGTCAAGTGCGACCGATTTTAGGAACGCCCGAAGA CCAGCAGGCGCTTTGGGACAACATGGACATCATCGACTGCTTCGCGACGG ACCACGGTATTTAGCATCATCGTAAAATCCCCTGAGACTCAATTCGCGAT TTTAATCGACTTTTATTCCCCAGCACCGCACACCGTCGAAGAGAAAACCA GCGAGAAACCTCCCCCCGGTTTTCCCGGACTCGAGACCGTTCTGCCGCTG CTTCTGAACGCCGTTCACGAAGGGAAATTGTCACTGAAGGTGAGAAGACT CTTTTCCAGTCGTGCCCACCGGCTCGACGACCTTCCGGAACCATCCGACC AAACAATCGCTGGAAACGGGTTTGGACTCACGCTGCTGAAGCGTGACACG CGATCCCGAAAAATCGCGATCTCTTTAATCTCATCGCAGCGAACTCGCGT CATGTGCGACGTTAAAAATTCTCAAGAAATTCAATAAAAAAGTAACCATT TAAAATGGTTTTATCGCGCGACGACGATTAGACGAGGCTAAAAATTAACC GGAGCGAATCCAGCGACGCGCGCATTATCAGACCGGTCAAGAGTCACTCG AGCTGAATCGAACATTCTTCGACGGTGTGACGAGAGCACGCGAAGCAAAA TAAAAACCAACGATAAGAAAACACTCGAGTACGATAGTGCCCACAATCTG ATAACTCTCCGCGCATTGACGATCGACGAACTAAGAGCCCCGAGCGATCA TGAAATAGCCAGCGCTCGATGTGCTCATAAATCCATGGCTTTCACTTCAG TCCGAAGTCTACCCTTTCGCCATTCGTCATACCTTCGAAAAGACAAATTC TGACTGATCGCGAGGCTTGAACTCATTTTTCGCACTATCTGCGTAACGCA TCATCGAAATCACTTTCGAACAATCGACGATCCGGCAAAAGACGTAAATC GATTTCAAGGCAATGCGAAGGATTCGTTTCCAAAGAATTTCAAACTCGTT CGACTGCGATGATCGAAATCTTTATGAAAATTCAGACGATTTTGTCACGC GCCCCCGTTCGAAGACGATTTTTTGAAAATAGTTTGAAATAGTTTTAGAG AATACGGTTTTTCAATTTCGAAATTTTGATATACTTTTTCATGAAGTAAT TATCAATTGCCGACTCACTCGATTCTCCCCACGCTCATCTTACCTTCACC TCCGCAGGATTTGGTCGACAAATTCCACAAAAATCCGAAACGGATTTTCA GCCTACCGGAGCAACCGAATACCTACGTCGAGGTGGATTTGGAGAACGAA TGGGTGATACCGGAGGCTCTGCCGTTCACGAAGTCGAAGTGGACGCCGTT CGCTGGAACGAAGGTCAGGGGCTCGGTTCACAGGGTCGTGCTCAGGGGCG AAGTCGCTTTCATCGACGGCCAGGTTCTCGTTAATCCAGGTTTCGGTCAG GATCTGAGGGAGGTTCAAGCGAATTTGAGCAGCCAAACGATTCTTCTTCC CTTGCCATCGGTCGACGTCAGCGCCGTTCCGCTTTCCGTTTTCGAGGGAC TCATTTCGCCAAATTATGAAAAAAGACCGCCGGATGCAGCCCACGAAGAG CACAACGGTTCGGGACCTTAATTTGCTTCCATCCTTGCACATTTTCCGCT CAATTTATTCATAAAGCGAGTATTTTTCGTTTAGAATTGCACAACAATTT GCTCCAAATCGGAACGAAGCCGGCTTCCCACCCGTCTCCGGACGTCGATC CACGAAATTATTCCGCCAAACTCGCAGCTCTTCCGAACTGCCTTTCTCCC GTGTCGTCGAGCATCGTCACGGCTTACAAAACCGAAAACAGTGCTCATCT CTGCGCCCCGGTCGCTCCGCCACTTCCGCGGATTCATCCCAGTCGCAGCA TCTACGGAAGGCACATTCTCTCCGTTGACATGTTCAGCAAGGAACAGTTA CACGATATGTTCAACCTCGCTCACACCTTCCGCGCTGACGTCACCAACAA GAGGCCTGTCCATCACATCTTGGCGGTAAGACTCGACCTTGGGTCGACCC TGGACCGCTCTACTGGATTGAAAAACGCAAAAAAAAACAATTTTTATCAA TAAAAAGGGAATGAAAAGCAAACGAAACGAAAGACCACGTCAGGCCCTCC GGATATTTGGACGTTTTCGAAAAAGCGTGAAAAAAGTTGGCGCGAAAGTA CTCAAGTTTTCGAAATAGTAGCAGCTCTTCCGTCGAATTTCTAAAATTTT AATCAACGAGTCCCACCGTGTTTTGGGCAACTCGTTTTCTTCGTAATTTT GAAAAATTTTTTGTATAAAATAACGCTGTCAAAAAATGAAAAAACGATCC ATTCGTTTAGGGTTTAGGAAAAAAAAACGCAAACGATTGAAGAGAGTAAA AAAATGGAATTGCACTTTTGTTGCACAGGGAAGAGAATTGATGTCGATAT TCTTCGAGAACAGCACACGAACATCCTGCAGTTTTACGGTCGCGATGCAT CGACTCGGCGGAACCGTCACGGTCGTCGACGTGTCTAAGTCTTCGATCAA AAAGGGAGAAACTCTCGAAGGTTGACGAGATTTTTTTTCCATTTCAAGTT CATCCGTGTTCTTGGTTTCGTGTTTTTCTAATCTTCGTTTTCGTTTACAG ATACGATAGCAGTGATGGCCAGTTATGGGGATGCTGTGGTCGTGCGACAC CCGGAGCCAGGTGCAGTCGAAGTGAGTATTCGTCTTGCTGCACAGAAAAT TTTGAGGCTATCGCGCCGTTCGAAGGCAGGCCGAAATCGTTATTTTTGGA AGCGCAGTAAATTTTATCCATTTCCAATTCCATGGAAATGTCGACTCGCA ACTTCGTCGAGGGGAAAACGTTTTTTTTTTTTTTTNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNGTTCGATCGATTACAGCGCGCAGCTC AACACTGTCGAGTCCCGATGATAAACGGAGGTGACGGAGTTGGCGAACAC CCGACCCAAGCCCTCCTCGATATTTTTACAATCAGAGAAGAGATCGGCAC CGTGAATGGTTTGACGATAACGATGGTCGGAGATCTGAAGCACGGAAGAA CGGTTCATTCGCTCGCGAGGTTCGTGCATGCGTTTCCCTAGAATTTATTC AGCTCACCTGGAATCAACGGAGTCTCGAATTCACATTGGATTCTTAGAGT CGCACGTAATGATCGAGGCTCGGTTTAAACTTCAATCGATTTTCCAATTT TTCGCTTCAGATTGCTGACTCTGTACAACGTTCAATTGCGATACGTCAGC CCCCCTGAACTCGGAATGCCTGATCACATAATCAGTTACGTAACCAAGCG CGGAATACGACAGAAAAAGATTGCTAGCCTCGAAGAGGTTCTTCCTGAAA CGGACGTTTTGTACATGACCCGAATTCAACGCGAGCGATTCACCACTCAA GAAGAATATGACAAGGTGCAGTTTCTGTTTCCATTTCGACTTATATTTTG ACGTCAAACATTGGAATAATTCAAATTTCATTGAAATTCGATTATAAAGA TACTCGGAAATATGAAAATTCCCAGTGAAATGCTAACTTTCCTAAACGTC TCAATTTTCGTCAATTTTTAAAATTTTTCCAGCGTTTTTTATTATCATTA TTCGGCACCCTTTTTACTCAATTCTGGATAATCGAATTTTTGTTTTCAGG CCTGCGGTCACTTCGTAGTGACACCTCAGCTCATGACACGAGCCAAAAGG AAAATGGTCGTGATGCATCCTTTGCCAAGAGTATTTGAAATAAGTCCTGA ATTCGACACGGACCCAAGAGCCGCCTATTTCCGGCAGGCCGAGTACGGCG TGTACGTCAGAATGGCGCTTCTTTTCATGGTGCTTGGAAACGCCTGA
back to top

Coding sequence (CDS) from alignment at scaffold_1295:26943..35389+

>g17088.t1 ID=g17088.t1|Name=g17088.t1|organism=Venturia canescens|type=CDS|length=2994bp|location=Sequence derived from alignment at scaffold_1295:26943..35389+ (Venturia canescens)
ATGATCGTCTTCCCGGTGACGTTCGCGTCTCGCCTCGACGGTATCTCGTC
GAATCGACGATATCTTTTTATTCCAAGGATCATAAAGACCGCTCAGGGTT
TACTGGCCTCGGTGCTGGCGGCACGAGGCTCCCATCTCGGTTCAATGCTT
TTGCAGACGAGTTCGAGCGGGCCCGGGATGAAGCCTAGAGCCACGGAAGT
CCGCAATTCAATTACGAGCACTCACACCAGCTGGATAATCGTGTTGCAAC
GAAATTTGAACTACTTTGGTCCGAAAATTGGCATAATTCTTGGAGAATTC
AAATCGCAGTTAAATCACTCGAACCAAGCTCCGACGGTGGTTGAGCCAGT
AGAATGGACGTTCGAGAACATCGAAAATGTGAACGAAGATTCGAGTACCA
ACGAACTTCGGCACCTCGCTGATTTCCTGTCGAAAAAGCACTTCGATCTG
GTCATTAATCTTCCGATGCGAAACGGAGGAGCGAGAAGGGTATCGAATTT
CATGACGCATGGTTATCGTACAAGGAGGCTTGCCGTTGATTATTCCGTGC
CACTTGTGACTGACGTCAAATGCGCCAAACTTTTGGTCGATGCGATAAGC
AAGCTGGGAGGCAAAACGCCTCCGATGAAAACGCACGCCGATTGCATGTC
TTCGCGAAAGCTCCTCAAACTGCCCGGCTTCATCGACGTCCACGTTCATA
CTCGCGATCCTGGAGCCACCGAGAAAGAGGATTATGCGTCTTGCACAGCA
GCAGCTCTCGCCGGAGGTGTTACAGCGATATTCGCGATGCCGAACACGAA
TCCTGCTGTGGTCGATAGTCAGTCGTTTGCTCAAGCGAAAGAGCGAGCCG
TAGCTGGTGCGAGGTGCGATTACGCAATTTTCGTCGGTGCATCATCGGAC
AATTGGAACGTAGCTCCGGAGTTAGCCCCCCTGGCTGCGGGCCTTAAGAT
GTATTTGAACGAGACATTCACGACTCTGCGACTGAACGACGTCAGTGTTT
GGATGAAGCACCTCGAAACGTGGCCGAAAAAATACCCGGTGTGCGTTCAC
GCCGAGGGTCAAACGACCGGAAACGTGATTCTCCTGGCGAGCTGTCACAA
CCGATCGGTGCACGTGTGTCACGTGGCACGAAAGGAAGAAATATTGATAA
TTCGAGCAGCGAAAGAAAAGGGTCTTGCTGTAACCTGCGAAGTTTCGCCA
CATCACCTTTTCCTGAATCAAACCGACCTCGAGAGAATCGGTTACGGGAA
AGGTCAAGTGCGACCGATTTTAGGAACGCCCGAAGACCAGCAGGCGCTTT
GGGACAACATGGACATCATCGACTGCTTCGCGACGGACCACGCACCGCAC
ACCGTCGAAGAGAAAACCAGCGAGAAACCTCCCCCCGGTTTTCCCGGACT
CGAGACCGTTCTGCCGCTGCTTCTGAACGCCGTTCACGAAGGGAAATTGT
CACTGAAGGATTTGGTCGACAAATTCCACAAAAATCCGAAACGGATTTTC
AGCCTACCGGAGCAACCGAATACCTACGTCGAGGTGGATTTGGAGAACGA
ATGGGTGATACCGGAGGCTCTGCCGTTCACGAAGTCGAAGTGGACGCCGT
TCGCTGGAACGAAGGTCAGGGGCTCGGTTCACAGGGTCGTGCTCAGGGGC
GAAGTCGCTTTCATCGACGGCCAGGTTCTCGTTAATCCAGGTTTCGGTCA
GGATCTGAGGGAGGTTCAAGCGAATTTGAGCAGCCAAACGATTCTTCTTC
CCTTGCCATCGGTCGACGTCAGCGCCGTTCCGCTTTCCGTTTTCGAGGGA
CTCATTTCGCCAAATTATGAAAAAAGACCGCCGGATGCAGCCCACGAAGA
GCACAACGAATTGCACAACAATTTGCTCCAAATCGGAACGAAGCCGGCTT
CCCACCCGTCTCCGGACGTCGATCCACGAAATTATTCCGCCAAACTCGCA
GCTCTTCCGAACTGCCTTTCTCCCGTGTCGTCGAGCATCGTCACGGCTTA
CAAAACCGAAAACAGTGCTCATCTCTGCGCCCCGGTCGCTCCGCCACTTC
CGCGGATTCATCCCAGTCGCAGCATCTACGGAAGGCACATTCTCTCCGTT
GACATGTTCAGCAAGGAACAGTTACACGATATGTTCAACCTCGCTCACAC
CTTCCGCGCTGACGTCACCAACAAGAGGCCTGTCCATCACATCTTGGCGG
GAAGAGAATTGATGTCGATATTCTTCGAGAACAGCACACGAACATCCTGC
AGTTTTACGGTCGCGATGCATCGACTCGGCGGAACCGTCACGGTCGTCGA
CGTGTCTAAGTCTTCGATCAAAAAGGGAGAAACTCTCGAAGATACGATAG
CAGTGATGGCCAGTTATGGGGATGCTGTGGTCGTGCGACACCCGGAGCCA
GGTGCAGTCGAACGCGCAGCTCAACACTGTCGAGTCCCGATGATAAACGG
AGGTGACGGAGTTGGCGAACACCCGACCCAAGCCCTCCTCGATATTTTTA
CAATCAGAGAAGAGATCGGCACCGTGAATGGTTTGACGATAACGATGGTC
GGAGATCTGAAGCACGGAAGAACGGTTCATTCGCTCGCGAGATTGCTGAC
TCTGTACAACGTTCAATTGCGATACGTCAGCCCCCCTGAACTCGGAATGC
CTGATCACATAATCAGTTACGTAACCAAGCGCGGAATACGACAGAAAAAG
ATTGCTAGCCTCGAAGAGGTTCTTCCTGAAACGGACGTTTTGTACATGAC
CCGAATTCAACGCGAGCGATTCACCACTCAAGAAGAATATGACAAGGCCT
GCGGTCACTTCGTAGTGACACCTCAGCTCATGACACGAGCCAAAAGGAAA
ATGGTCGTGATGCATCCTTTGCCAAGAGTATTTGAAATAAGTCCTGAATT
CGACACGGACCCAAGAGCCGCCTATTTCCGGCAGGCCGAGTACGGCGTGT
ACGTCAGAATGGCGCTTCTTTTCATGGTGCTTGGAAACGCCTGA
back to top