g17099.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg17099.t1
Unique Nameg17099.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1299contigscaffold_1299:12717..20832 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g17099g17099Venturia canescensgenescaffold_1299 12717..20832 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17099.t1-start_codong17099.t1-start_codonVenturia canescensstart_codonscaffold_1299 12717..12719 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17099.t1-CDSg17099.t1-CDS-1Venturia canescensCDSscaffold_1299 12717..12837 +
g17099.t1-CDSg17099.t1-CDS-2Venturia canescensCDSscaffold_1299 13527..13680 +
g17099.t1-CDSg17099.t1-CDS-3Venturia canescensCDSscaffold_1299 16631..16859 +
g17099.t1-CDSg17099.t1-CDS-4Venturia canescensCDSscaffold_1299 17208..17339 +
g17099.t1-CDSg17099.t1-CDS-5Venturia canescensCDSscaffold_1299 17581..17754 +
g17099.t1-CDSg17099.t1-CDS-6Venturia canescensCDSscaffold_1299 18046..18137 +
g17099.t1-CDSg17099.t1-CDS-7Venturia canescensCDSscaffold_1299 18474..18675 +
g17099.t1-CDSg17099.t1-CDS-8Venturia canescensCDSscaffold_1299 19000..19188 +
g17099.t1-CDSg17099.t1-CDS-9Venturia canescensCDSscaffold_1299 20239..20379 +
g17099.t1-CDSg17099.t1-CDS-10Venturia canescensCDSscaffold_1299 20680..20832 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17099.t1-exong17099.t1-exon-1Venturia canescensexonscaffold_1299 12717..12837 +
g17099.t1-exong17099.t1-exon-2Venturia canescensexonscaffold_1299 13527..13680 +
g17099.t1-exong17099.t1-exon-3Venturia canescensexonscaffold_1299 16631..16859 +
g17099.t1-exong17099.t1-exon-4Venturia canescensexonscaffold_1299 17208..17339 +
g17099.t1-exong17099.t1-exon-5Venturia canescensexonscaffold_1299 17581..17754 +
g17099.t1-exong17099.t1-exon-6Venturia canescensexonscaffold_1299 18046..18137 +
g17099.t1-exong17099.t1-exon-7Venturia canescensexonscaffold_1299 18474..18675 +
g17099.t1-exong17099.t1-exon-8Venturia canescensexonscaffold_1299 19000..19188 +
g17099.t1-exong17099.t1-exon-9Venturia canescensexonscaffold_1299 20239..20379 +
g17099.t1-exong17099.t1-exon-10Venturia canescensexonscaffold_1299 20680..20832 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17099.t1-introng17099.t1-intronVenturia canescensintronscaffold_1299 20380..20679 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17099.t1-stop_codong17099.t1-stop_codonVenturia canescensstop_codonscaffold_1299 20830..20832 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17099.t1g17099.t1-PAVenturia canescenspolypeptidescaffold_1299 12717..20832 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g17099.t1 ID=g17099.t1|Name=g17099.t1|organism=Venturia canescens|type=mRNA|length=1587bp|location=Sequence derived from alignment at scaffold_1299:12717..20832+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGAACGTTCACAAGAGGTGCGAGGTGAGTGTGCCGAATCTGTGCGGTTG
CGACCACACAGAAAGACGAGGTCGTATAGAGCTGGAAATCACCGCATCCT
CCAACAAACTCGTCGTCGAAGTAAAACAAGGGCGGAATCTTATCCCAATG
GATCCGAACGGTCTTTCGGACCCTTACGTCAAACTCAAACTAATCCCGGA
CACGGATGGAGTGAAGAAAAAAACAAAGACAATCAAAGCTTCTTTAAATC
CAGAATGGAACGAGACAATCACTTTCGACCTCAAACCCGAGGACAAGGAC
AGACGCCTTCTGATCGAAGTCTGGGACTGGGACAGAACATCGAGGAACGA
TTACATGGGCTCCCTGTCGTTTGGTATATCGGAACTATTGAAAGCACCTG
CAACCGGTTGGTTCAAACTTTTGACGCAGGAAGAGGGAGAGTTTTACAAT
GTTCCCGTACCGGAGGAGGGTGTCGACCTTGCCGAGCTCAAATCAAAGAT
GCGAAAAACATCGGTAACGAAAAAAGTTCCACAACCACAAGACAAAGATG
TTCCACACAACATGGGCAAGAGCGATTTAATAAGAGCGAGCGATTTCAAT
TTCCTCATGGTGCTCGGAAAAGGCAGTTTCGGAAAGGTATTGCTAGCCGA
ACGAAAAGGTACGGACGAACTTTATGCGATCAAGATTCTGAAGAAAGACA
TTATAATTCAAGATGACGACGTCGAATGTACGATGGTTGAGAAACGTGTA
CTCGCGCTCGCAAATAAACCGCCGTTCCTGGTGCAGCTTCACTCCTGTTT
TCAGACTATGGATCGCCTTTACTTTGTTATGGAATACGTAAACGGTGGGG
ATCTTATGTTCCAAATACAACAGTGTGGCAAGTTTAAGGAACCCGTGGCA
GTATTTTACGCCTCGGAAATCGCTATCGGTTTGTTTTACCTTCACGCGAG
AGGAATCGTGTATCGGGATCTGAAGCTCGACAACGTTCTACTTGATCACG
ACGGTCATATAAAAATCGCCGATTTTGGTATGTGCAAAGAAGGCATCTCG
GGTGACAAAACGACCAAAACATTTTGTGGAACGCCTGACTATATTGCTCC
GGAGATTATTCTTTATCAACCTTATGGAAAATCGGTTGATTGGTGGGCTT
ATGGTGTTCTGTTGTACGAGATGCTCGTCGGACAACCACCGTTTGATGGC
GAAGACGAGGAAGAATTATTTGCAGCAATCACAGATCACAATGTTAGTTA
CCCGAAGAGCCTTTCCAAAGAGGCAAAAGAAGCTTGCAAAGGGCTCCTAA
CTAAGAATCCGAGCAAGAGACTGGGTTGCGGTTTTCGGGGTGAGGAAGAC
GTACGAGGTCATGCTTTCTTCCGGCGTATAGATTGGGAAAAAATAGAAAA
TCGTGAGGTTCAACCTCCCTTCAAGCCAAAGATCAAACATAGAAAGGACG
TGAGCAACTTTGACAAGCAGTTCACATCAGAGAAGACGGACCTAACGCCA
ACCGACAAATTATTCATGATGAATCTCGATCAAACGGAATTCATGGGTTT
CTCGTTCCTGAATCCAGAATTCATTCAACATATTTAA
back to top

protein sequence of g17099.t1

>g17099.t1-PA ID=g17099.t1-PA|Name=g17099.t1|organism=Venturia canescens|type=polypeptide|length=528bp
MNVHKRCEVSVPNLCGCDHTERRGRIELEITASSNKLVVEVKQGRNLIPM
DPNGLSDPYVKLKLIPDTDGVKKKTKTIKASLNPEWNETITFDLKPEDKD
RRLLIEVWDWDRTSRNDYMGSLSFGISELLKAPATGWFKLLTQEEGEFYN
VPVPEEGVDLAELKSKMRKTSVTKKVPQPQDKDVPHNMGKSDLIRASDFN
FLMVLGKGSFGKVLLAERKGTDELYAIKILKKDIIIQDDDVECTMVEKRV
LALANKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMFQIQQCGKFKEPVA
VFYASEIAIGLFYLHARGIVYRDLKLDNVLLDHDGHIKIADFGMCKEGIS
GDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDG
EDEEELFAAITDHNVSYPKSLSKEAKEACKGLLTKNPSKRLGCGFRGEED
VRGHAFFRRIDWEKIENREVQPPFKPKIKHRKDVSNFDKQFTSEKTDLTP
TDKLFMMNLDQTEFMGFSFLNPEFIQHI
back to top

mRNA from alignment at scaffold_1299:12717..20832+

Legend: start_codonpolypeptideCDSexonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g17099.t1 ID=g17099.t1|Name=g17099.t1|organism=Venturia canescens|type=mRNA|length=8116bp|location=Sequence derived from alignment at scaffold_1299:12717..20832+ (Venturia canescens)
ATGAACGTTCACAAGAGGTGCGAGGTGAGTGTGCCGAATCTGTGCGGTTG CGACCACACAGAAAGACGAGGTCGTATAGAGCTGGAAATCACCGCATCCT CCAACAAACTCGTCGTCGAAGGTAAGTTCACGTCAATCAAATTCTTATCT TATGAGGGTAACGTTATTTTATATACGGTCTTATACCATGCTTATGATTG TTGATAAATTTTCAAATATTCGAAAATAATTTAAAGAAAAACTAAGTGAA AAGAAAATGTTATATATTTTTTTGAAGTACTGAAGTTTCTCACGAGTCCT ATTACCTCATTAAAACTTTTCCAAACTCCGGACATGAACGAACGTCGCGT CGGCTTGTACCTGAAACTTATTGCTCGAACGACATAGTCCTCGACAAGAG AGTCGAGTTGAAAGGAAACATTGTTCTTCGATTTTTCAAATTTTCCTTTT AATTACTTTGTGTCTAGATGCTAAATCGAGACTTAATTAATATTGAAAAA ACATCGGATCACATTTTGTCATGCGAAATTTTTCACGACCGTTTTTCTCG AATTTCATTCTGATCCTTAATCGGGGCTTTTTTAATCCTTCACGAAGTAA TTAGTATATCAAACCAGAACTTTCAAAGTTATCAATGAAGAAGAGTTTTC GGTATCTTTTTACATGACGCCGAATTTAAAAGTACTACATTTTCCCCTGA AATAACAACGAGTTATCAATTCCTTTTTCCATCGTTTACTCGACCTCAAA ATTTGCATGGTTTTCTACTTTTTTCGACAACAAAAAACGCTCTACTCGTT TTCTTTGCAGTAAAACAAGGGCGGAATCTTATCCCAATGGATCCGAACGG TCTTTCGGACCCTTACGTCAAACTCAAACTAATCCCGGACACGGATGGAG TGAAGAAAAAAACAAAGACAATCAAAGCTTCTTTAAATCCAGAATGGAAC GAGACAATCACTTTGTAAGCACTGAGAGAACTCAATTTCATTATATTGTT AATAAATGTCATTATATTCCGAGAAATACTCAGGTTCCATATTTTTATTT CATTCTCGTTTTGATAAGGTCTCATTTTCATTCGTGGCTCAAATTTCCAC AAAAATTTCCGCATGTGATTGTAACTTTACGTTTTCAAAAAAATATAGAA TTTCTTGTAATATTTGAAATTAAGTTGTCTCAACGAAAAATAATTTGTTC AATGCGCGCAAAAAAACATTCAAATGTTTCAACGAAATTTCGTTTTCCGT GAAGTTTTGCATTTCAGCGTAATGCAAGTGTGATAGGCGTGTTTTTTCTT TAACTGATTCTGGTGGAAATTGTTCTCAATACGGATCCGCATTGATGAAA CGGTTGATTTTACCTTTTGCATGCATGCGACGTTCGACGCTCCAATTGTC AGTTTTCTCCGTTCACCGTGTGTTATTCATTCATACCAAATTATAAAATC CATTTTTTTTCAGTACTTCAAAGATTTTGTATTCGTTCTCGAGAATTTAC GATGATTCGCAAAAACTTTTAAAGAAACAAGTCAAACCGTTTTAGAATTA TTTCACCCCAAAAATCATCTCTGAAAAAGCATTAAAATCATTTGAAAGAT CATTAATCAAAGTATTTTTTGCAACTCATGAAATTGAAAAACATGACTCG TCAAAAGTCATATAGTTCGCGGGGCGTCGAATACACAAGACTTTATATGA ATTTATAAAATCTAGTCACACCAGCACAAGCATCGCGCAATTAACCGATT GCTTGACTCTTTAAGGTTGTTGTGGGGTCAGGACGAAACGATGTCACTGA GATGAAATTTTTTGTGAACGTTCATGATCCCTTTACTAATTCATCTGTTA AATTTCAAAACGATTCACAGTACAATTATTTAGAAAAAAAATCGCAAAGT TGGGTGTGCTCATCGTGTTATGTTTATGAGAATGTTCCGAACGTTTTTCA GTATATTATAATAATATATCTGCCGAGAAAACGATGCCACAGAGTTGAAA AAACAGGTACGGTTAAATCGAATATCGGACTAACCGTTGGTGCCTTGAAA ATGATCATTTACAGTACAGATTCAAAGGTATTAATGATTATGATCGCGAC TGCCCAAGAGCTCCCTTCCTTAACGATGTTTTTTTCCCGGACCGTTGTGC ATGAGGTTGAGAAACAAGGACTTCGATTTTGAGGTTATGAACGGGGTTGT TGCCAATTTGTCTTTCAATAATTGATCTCAAACAAATTATCGAAAATAAT GCCATCGTTGCGTTTCGAGCGGCTTGAACGCTGAAGTCAACCTACTCGCG AGAAACGCAAGTAGTTTATTTTTATTTTTATCGGGATAAGTTCCGGTCTC GTCCTCTACAGGGTGATTCTCGGAGAGTGGTCGGTCAGGATAATAGAATG GATGATTTTACGTTTGATAAATTTATTAAAATTGTCTGTAAAAGTAACAT GCACCCAACCATTCACCAAATGTACACAGAATAGATACGTGACACCATAA ACTAATAGAAATAATTCCTATAATCATTACTTTATCATAAATGCATATTC TTTTAAACTAATGTGGATGTTTTCCTCGAAAAATTACATCAAATACGACG ATAATTTGGCGATAAACAGTTGGTAATAATTCATCGGTTCCGTGCATAAG CATAGAGCGCCTCTCTCACGCTTCGACCCCGACGGCTAGACCCCACAACA AATTAAGCAAGAGAATGAAAAATAATATAAAGAAAGAAAGAGCGAGAGGG AAGGAGTGATTAGCTCTTGGTAAAAGTATTCTTCTCGCAGTAAAGATGCG TAGGTGTATCAGGGCTTTTTCATGATTGGTTTTTATACTGACGACATGCC AAGATCCAAATATTTTAGATATTTTAGATATTTTGAATATTGAATTAATC CCCATCACTTTATTATTCATTATATCATTATTTCGTGAAGTGAACTCGCT TTCGAAAAGAATCGATTTATATTTTTATCGGTTCCAATTTTGATGCTCAA ACCATTTTAAAAGCATTTAAGGATGTATAAGCACTAGGCTCCATTTCAGA TGGCACTCTAATTTTTTTGTACATTATAGTCCAAGCTTAAAACTTAATCT CTGTGAAATTTCAAGGTCTCTTAACGACTGTTTAATCGAAATATTTTTAG TCAAAAGAACACAATTTAACGTGTCGTATGTAGACACAATGACTTCAAAG CCTGTATAACTTAAAATTTCATGTATTTTTATATGAGATGTTAATCATAA AAAAAGTCTATTATATGCATTGAACCCTAAGAATTTTAACAGTTCGTTAG AAAAAGGGGGTCAACAGACATCTGAATTAGAAATATAAAGTTAAAGACGA CAAATACTCACGGAACCTCAGGATTTCGTAACCCCGTGAATTTGTGGCAA CGTCGCACAACCTATAAATGTAAACATTTGTACAATGCTCTATGTAACTT TTTTGTCGTTATGGTAAGCTCTAACCTCAGCTGTCAACTGACTACGTCTG ATGTTGTAAGACCCAAATTTTTCACACTGCACTACCGAGTCGTGTTAATA ACTCTGCATAAAATCCTTTTCGTAATGAAATGAACTTAAATATTATTTAG CATTAAAAAATTATTGCAAGATTTCTTAATAATATTGTGCTATATATGAT TGCCCGTGGTAATTTCTTTGAAAAAATATGGTCAAAAACTGTCCATTGAC TAGTACGAACCGCTTTTACATCCTTAAAGATCATTACGTTTTTTTGTACT TGTATGCTGAAGTAAAAAGCAAATTTTTGCAATTGATAGAATATAATGTC GAAGTTAATCTCAAATTTAGAATTCACTAGTCTCTGACGTCAGGAGAAAC TTAATAACTTGCCTCGAAGATCAATGTTATTTTTCACCTTTTGTTCATAC ATTCAATTTACCAGCGACCTCAAACCCGAGGACAAGGACAGACGCCTTCT GATCGAAGTCTGGGACTGGGACAGAACATCGAGGAACGATTACATGGGCT CCCTGTCGTTTGGTATATCGGAACTATTGAAAGCACCTGCAACCGGTTGG TTCAAACTTTTGACGCAGGAAGAGGGAGAGTTTTACAATGTTCCCGTACC GGAGGAGGGTGTCGACCTTGCCGAGCTCAAATCAAAGATGCGAGTGCGTA CAAACTCACAGTTTTTTTTGTCCCTCTTAAACTGCGGTATGAAAATTCTT CAAATCCACTTTTCATCATATAACAAAAGGCCATCTTATTACGTGACTTT TTGTGTTATAATTTTCTTGAATGATAGACACGTGCATGTCGAAGAAAAAA TTGCTTCATGGGTTTTTTTGTTATCCGTGGTACAGTTCCCATTTAAAATG TTATATCTTTGCAAAATTTTTTCACTTAATATTTTCAGAATATAATTGAA AAAAGCCCCTGTTTTTGCGATTGTCTTCGAAAATCAATTACCAGTTTCCA CAGAAATAATCTCATTTTTTCGTTATCATCGTCATGTCTAGAAAACATCG GTAACGAAAAAAGTTCCACAACCACAAGACAAAGATGTTCCACACAACAT GGGCAAGAGCGATTTAATAAGAGCGAGCGATTTCAATTTCCTCATGGTGC TCGGAAAAGGCAGTTTCGGAAAGGTGCGAAATGTTTGCCTCGTTTCCATC CACATCCATTTTTCTTTTCTCACGATCTTTCGATCATTAATTTCGTATTT ACTTGAAATAAAAAAAAAACCATGCATTATTTCTTGCAAAAAAGTGGAAA GTTGCGGAGAAAAAAATATTCATACATTTTTTGCTTGCTCTTCTCGAATT CTTTTTATTCATGACTACTTTTTTTTCGTTCCAATCGGTAACAAGTGTTT GACAATGAACTCAGGTATTGCTAGCCGAACGAAAAGGTACGGACGAACTT TATGCGATCAAGATTCTGAAGAAAGACATTATAATTCAAGATGACGACGT CGAATGTACGATGGTTGAGAAACGTGTACTCGCGCTCGCAAATAAACCGC CGTTCCTGGTGCAGCTTCACTCCTGTTTTCAGACTATGGTGAGTGGAAAC ACAGTGTGCCTGATATTGTGGTATCCAAAAATCAGGACGGAAAAATGATT ATGTCGTGAGACAATTTAAATAAAATACTAACAAAAATAACCATTTCGGA GTGTTAAAAAATGAAAAAATCTTGCAACTGTATTTTTATCTTCCCTCACA AACTTCATCAACGTTCAGGTCACCCTGTATTTTTGTACACATGAATGAGC GACTTTCCAAGAAAAACAGCTTTCATGTGCTCGTCTGCACGTTTGTAAGT TTCATGAAACTTGGTCTATCTCGTTGCAGGATCGCCTTTACTTTGTTATG GAATACGTAAACGGTGGGGATCTTATGTTCCAAATACAACAGTGTGGCAA GTTTAAGGAACCCGTGGCAGTGTAAGTTTTCAAAAGTTATACAACTCTTA GACTTGAGTGAACAAAGACTGTATACATCAATCGGGGTCCAATGCAAAGA TTCTACTGGTCGCTAAAGTGTTTCTCAATTATTAAAAGAAACAAAAAATC TCATATTATTTGTACATTTAAAATTAATTGTCCGATACTACATAGTATTA ATTTTGTCATATTCATTGCACATTTTCAACGCTATTTCCGTAGCTTTATG ACAAACTTTTTGTTACAATACTGCGCGAAAGTTAAAATTAAAAAAAAATT TTTAAAAAAAGAATCGTCGGATTTAGATATTCATGTAGAAAAATTTTCGG ATGTCAGATTTTACGCCTCGGAAATCGCTATCGGTTTGTTTTACCTTCAC GCGAGAGGAATCGTGTATCGGGATCTGAAGCTCGACAACGTTCTACTTGA TCACGACGGTCATATAAAAATCGCCGATTTTGGTATGTGCAAAGAAGGCA TCTCGGGTGACAAAACGACCAAAACATTTTGTGGAACGCCTGACTATATT GCTCCGGAGGTAAATTGTTTATTCATTCTTCAACTCACTTTCTTGCAGGT TACTCCAAATCATATATATTTAACAAAGTTTGGCTGACTCAGAGTAAAAA ATGGAGCTGACCGATATATTTGTTCTATGTTATTTTTTAGTAAACAACTA AATATGTCGATTGTTTTGTATACATTATAAAAGAGTACGACTTTTGGATT TAAGCGGCGAATAAATATAATTTTTGCGATCGAAAAATCTTGAGAGATTA ATCGAGAAAAATATTTTTTTTTATATTTCAGCATTTACTATTTTTCGGTG AATAATTTGTTGTTTTTTTTTGTTATTGTGAAGATTATTCTTTATCAACC TTATGGAAAATCGGTTGATTGGTGGGCTTATGGTGTTCTGTTGTACGAGA TGCTCGTCGGACAACCACCGTTTGATGGCGAAGACGAGGAAGAATTATTT GCAGCAATCACAGATCACAATGTTAGTTACCCGAAGAGCCTTTCCAAAGA GGCAAAAGAAGCTTGCAAAGGGGTAAGTTCAACTTTGTGTATGCGAATAT TCGAGCGGGGGTGGGGTTCAATATGTCGAATAACTGAATTGTAGAACGGT CGATATTTCGAAATTTTAAAAGTTGTGATATCAGTTTGGAGAAAAATAAG TAATTCGAAATTCTTATTCCCGGTCGACTATTCAGCAGATTGCGTGTTTA ATCAAAAATTCCTTCTTTGAATTCGTGTTTACCCGAAAATATATATTTCA ATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNCGAATGCAATTTTAACAGACCATCCCAATGTCAAAAGTTCATATTT TCGAATTCAAAATGGAGAGTAATTGTTTTACAGACAGACCAGAATATAGA GTAGCAAAAAATCGAAAGTAAATTTTtcgagcctataaaacttagatatg tagaatagcgatagctcgaaaaggcgaaagtcaaaatggcggtgtttaaa aTTGGAGATCTGGAGATTGGTCTGAGTAAGTGAGTGAGTGAGACGCGTGT ATTTGGAGCTCCACTGCATTTCTTTATTTTGATCGATCGACTTTCTAACG TTTCGCTAtttttactgttcgactttttggtgtttcagtatttcaacctc aggtaatatttggtctttcgttattatattttcaaaattgtgaattTTCA CGGTATCGCTGACTGTATGAATCGAAAGAGTGATAGTCGAATTTTCGAAA AATCGATATTTTAGTCATCGTCCTATAGGCGATTGTTACATTCTANNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNTCTGTCTCCATATTATAATTCGA AGTTTATAAACTCGAGATTTTAGCTGTTCGAAATTTTAGTCATTCCAACA TTTGATCCCCACCCTCAACCGGTAAAGGTGTTTACATGCAGCTGATATAA AATCGGATGTTTTTTTGTTTAGCTCCTAACTAAGAATCCGAGCAAGAGAC TGGGTTGCGGTTTTCGGGGTGAGGAAGACGTACGAGGTCATGCTTTCTTC CGGCGTATAGATTGGGAAAAAATAGAAAATCGTGAGGTTCAACCTCCCTT CAAGCCAAAGATCGTAAGTCTGAATAAACAGAAAATTGCATTCAATTTTC ATTTTAATTTCTTAAAGGTTGCTTGAAAACGTGTTCATTCTTGAAGACGT TTGCCCAGTAAGAAAACTTCTAATTTCGTTCAGTGATAATTAAATGACTT TTTAAAAAGAATAATGAAAAGAAATTGAGTACAAGCGTCCAGGAACTCTT TTAAATTTTCATTAAATATATCGAGTGAAGAATGTTTTTACTAAAAATTT CGAAACAAAAAATAAAAGTTCATGAATATAGATGTGAACATAGAATCTCG TGAATATTTACAGAAACATAGAAAGGACGTGAGCAACTTTGACAAGCAGT TCACATCAGAGAAGACGGACCTAACGCCAACCGACAAATTATTCATGATG AATCTCGATCAAACGGAATTCATGGGTTTCTCGTTCCTGAATCCAGAATT CATTCAACATATTTAA
back to top

Coding sequence (CDS) from alignment at scaffold_1299:12717..20832+

>g17099.t1 ID=g17099.t1|Name=g17099.t1|organism=Venturia canescens|type=CDS|length=1587bp|location=Sequence derived from alignment at scaffold_1299:12717..20832+ (Venturia canescens)
ATGAACGTTCACAAGAGGTGCGAGGTGAGTGTGCCGAATCTGTGCGGTTG
CGACCACACAGAAAGACGAGGTCGTATAGAGCTGGAAATCACCGCATCCT
CCAACAAACTCGTCGTCGAAGTAAAACAAGGGCGGAATCTTATCCCAATG
GATCCGAACGGTCTTTCGGACCCTTACGTCAAACTCAAACTAATCCCGGA
CACGGATGGAGTGAAGAAAAAAACAAAGACAATCAAAGCTTCTTTAAATC
CAGAATGGAACGAGACAATCACTTTCGACCTCAAACCCGAGGACAAGGAC
AGACGCCTTCTGATCGAAGTCTGGGACTGGGACAGAACATCGAGGAACGA
TTACATGGGCTCCCTGTCGTTTGGTATATCGGAACTATTGAAAGCACCTG
CAACCGGTTGGTTCAAACTTTTGACGCAGGAAGAGGGAGAGTTTTACAAT
GTTCCCGTACCGGAGGAGGGTGTCGACCTTGCCGAGCTCAAATCAAAGAT
GCGAAAAACATCGGTAACGAAAAAAGTTCCACAACCACAAGACAAAGATG
TTCCACACAACATGGGCAAGAGCGATTTAATAAGAGCGAGCGATTTCAAT
TTCCTCATGGTGCTCGGAAAAGGCAGTTTCGGAAAGGTATTGCTAGCCGA
ACGAAAAGGTACGGACGAACTTTATGCGATCAAGATTCTGAAGAAAGACA
TTATAATTCAAGATGACGACGTCGAATGTACGATGGTTGAGAAACGTGTA
CTCGCGCTCGCAAATAAACCGCCGTTCCTGGTGCAGCTTCACTCCTGTTT
TCAGACTATGGATCGCCTTTACTTTGTTATGGAATACGTAAACGGTGGGG
ATCTTATGTTCCAAATACAACAGTGTGGCAAGTTTAAGGAACCCGTGGCA
GTATTTTACGCCTCGGAAATCGCTATCGGTTTGTTTTACCTTCACGCGAG
AGGAATCGTGTATCGGGATCTGAAGCTCGACAACGTTCTACTTGATCACG
ACGGTCATATAAAAATCGCCGATTTTGGTATGTGCAAAGAAGGCATCTCG
GGTGACAAAACGACCAAAACATTTTGTGGAACGCCTGACTATATTGCTCC
GGAGATTATTCTTTATCAACCTTATGGAAAATCGGTTGATTGGTGGGCTT
ATGGTGTTCTGTTGTACGAGATGCTCGTCGGACAACCACCGTTTGATGGC
GAAGACGAGGAAGAATTATTTGCAGCAATCACAGATCACAATGTTAGTTA
CCCGAAGAGCCTTTCCAAAGAGGCAAAAGAAGCTTGCAAAGGGCTCCTAA
CTAAGAATCCGAGCAAGAGACTGGGTTGCGGTTTTCGGGGTGAGGAAGAC
GTACGAGGTCATGCTTTCTTCCGGCGTATAGATTGGGAAAAAATAGAAAA
TCGTGAGGTTCAACCTCCCTTCAAGCCAAAGATCAAACATAGAAAGGACG
TGAGCAACTTTGACAAGCAGTTCACATCAGAGAAGACGGACCTAACGCCA
ACCGACAAATTATTCATGATGAATCTCGATCAAACGGAATTCATGGGTTT
CTCGTTCCTGAATCCAGAATTCATTCAACATATTTAA
back to top