g17100.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg17100.t1
Unique Nameg17100.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1299contigscaffold_1299:29157..37312 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g17100g17100Venturia canescensgenescaffold_1299 29157..37312 -


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17100.t1-stop_codong17100.t1-stop_codonVenturia canescensstop_codonscaffold_1299 29157..29159 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17100.t1-CDSg17100.t1-CDS-6Venturia canescensCDSscaffold_1299 29157..29386 -
g17100.t1-CDSg17100.t1-CDS-5Venturia canescensCDSscaffold_1299 30080..30394 -
g17100.t1-CDSg17100.t1-CDS-4Venturia canescensCDSscaffold_1299 31021..31363 -
g17100.t1-CDSg17100.t1-CDS-3Venturia canescensCDSscaffold_1299 35573..35935 -
g17100.t1-CDSg17100.t1-CDS-2Venturia canescensCDSscaffold_1299 36087..36307 -
g17100.t1-CDSg17100.t1-CDS-1Venturia canescensCDSscaffold_1299 37198..37312 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17100.t1-exong17100.t1-exon-6Venturia canescensexonscaffold_1299 29157..29386 -
g17100.t1-exong17100.t1-exon-5Venturia canescensexonscaffold_1299 30080..30394 -
g17100.t1-exong17100.t1-exon-4Venturia canescensexonscaffold_1299 31021..31363 -
g17100.t1-exong17100.t1-exon-3Venturia canescensexonscaffold_1299 35573..35935 -
g17100.t1-exong17100.t1-exon-2Venturia canescensexonscaffold_1299 36087..36307 -
g17100.t1-exong17100.t1-exon-1Venturia canescensexonscaffold_1299 37198..37312 -


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17100.t1-introng17100.t1-intronVenturia canescensintronscaffold_1299 36308..37197 -


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17100.t1-start_codong17100.t1-start_codonVenturia canescensstart_codonscaffold_1299 37310..37312 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g17100.t1g17100.t1-PAVenturia canescenspolypeptidescaffold_1299 29157..37312 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g17100.t1 ID=g17100.t1|Name=g17100.t1|organism=Venturia canescens|type=mRNA|length=1587bp|location=Sequence derived from alignment at scaffold_1299:29157..37312- (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGATGGACCGAAAAATGCACGACGACTTCGTAATGAAGAGAGAATCTCG
AAAGTTTGGCGACGAAGTTTATCCAGAAAATCCAAATACTGGTCTATGGT
TTGATCACGAGACAGACAATTCGTTCTGGTATGAAGACGCCCAGATAGTA
CTCAAGAAAAAGCTTCAAAGGAGCCTAAACACAGGAGTCGCTAAAAATGT
GATTGTATTTTTGGGCGACGGAATGTCAATTCCGACGTTGATGGCGACCA
GAACGTACCTGGGACAACTCGAGGGCAAACCGGGCGAGGAAGGCTCTCTT
TATTGGGAACATTTTCCTTACACCGGTCTTTCGAAAACATGGTGCCTCGA
CAAACAAGTGCCGGATTCTGCTTGTACCAGCACGGCGTATCTTGGGGGTG
TCAAAACAAAGTCAGGAACAATTGGTCTCAATGGAAACGTTGTTCGTGGC
AAATGCGAAACTCAAATCAAGGAAAATCATGTTGACTCGATCGCTCAGTG
GGCTCAAGATCACGGCAAAGGAACCGGAATTGTCACCACAACAAGGATAA
CCCACGCTTCGCCAGGTGGAGCTTACGCCCACGTTGCAGAGAGACACTGG
GAAAGCGATAGCGATGTGATTATCGGGGGTTACGATCCCAAGGAGTGTGA
TGATATAGCCAAACAACTTGTTCGCTCGAGTCCTGGCAACAACTTCAAGG
TGGTTTTGGGAGGAGGTCGCCGATCATTCCTGCCAAAGGAAATTATCGAC
GAGGAGGGTGACGCAGGTGTACGTTCGGACGGAAAAAATTTGATCGATGA
ATGGAAAAAAGATAAAATGGAGCGTAATGGAAGACCCATTTATTTATGGA
ACCGTACGTCATTGCACGAGATTATCGATTATCCGGAAAAATACGACCAC
GTGCTGGGTCTTTTCGAGTCTAGTCACTGCCACTATCATCTCGAGGGCTC
GCCCGAAACTGAGCCAACGTTAGCTGAAATGACCGAGGCAGCGATCAGAG
TACTTCAAAAAGATGAAAATGGATTTTTCCTCTTCGTTGAAGGTGGTCGA
ATCGATCATGCTCATCACAACACATTCGCGACACTGGCTCTCGACGAGAC
AGTAGAACTTGCTAAGGCTGTTGAGAGAGCAACGGAGTTAACGTCAGAGA
AGGATACACTTATCATTACAACTTCGGATCATGCACACACGATGTCAGTT
TCCGGTTACCCGAAGAGAGGCAATCCGATCAATGATATCGTTGGAAAAAT
GGCTAAAGATGACATTCCATATGCGACGCTGACATACGCCAATGGTCCAG
GTTACAGACCACCCAATCAGGATGGTTCTCGATACGATCCATCTGAGGGC
GATTTTGAAAATCCTCGTCACATGTCCCCTGCTCTGGCTCCACTCGATTC
CGAGACTCATGGCGGCGATGACGTAGCGATTTTTGCGAATGGCCCATGGG
CTCATCTATTCACCGGAACAATACAACAAAGCAACATTCCACATTTTATC
GGTTTCGCGTCCTGCATAGGCAAAGGTGAATCAGATGCGTGCAAATTGAA
TCGTCGGTTCGCTTCCAAGCTGCCCAAATTTCATTGA
back to top

protein sequence of g17100.t1

>g17100.t1-PA ID=g17100.t1-PA|Name=g17100.t1|organism=Venturia canescens|type=polypeptide|length=528bp
MMDRKMHDDFVMKRESRKFGDEVYPENPNTGLWFDHETDNSFWYEDAQIV
LKKKLQRSLNTGVAKNVIVFLGDGMSIPTLMATRTYLGQLEGKPGEEGSL
YWEHFPYTGLSKTWCLDKQVPDSACTSTAYLGGVKTKSGTIGLNGNVVRG
KCETQIKENHVDSIAQWAQDHGKGTGIVTTTRITHASPGGAYAHVAERHW
ESDSDVIIGGYDPKECDDIAKQLVRSSPGNNFKVVLGGGRRSFLPKEIID
EEGDAGVRSDGKNLIDEWKKDKMERNGRPIYLWNRTSLHEIIDYPEKYDH
VLGLFESSHCHYHLEGSPETEPTLAEMTEAAIRVLQKDENGFFLFVEGGR
IDHAHHNTFATLALDETVELAKAVERATELTSEKDTLIITTSDHAHTMSV
SGYPKRGNPINDIVGKMAKDDIPYATLTYANGPGYRPPNQDGSRYDPSEG
DFENPRHMSPALAPLDSETHGGDDVAIFANGPWAHLFTGTIQQSNIPHFI
GFASCIGKGESDACKLNRRFASKLPKFH
back to top

mRNA from alignment at scaffold_1299:29157..37312-

Legend: polypeptideCDSexonstart_codonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g17100.t1 ID=g17100.t1|Name=g17100.t1|organism=Venturia canescens|type=mRNA|length=8156bp|location=Sequence derived from alignment at scaffold_1299:29157..37312- (Venturia canescens)
ATGATGGACCGAAAAATGCACGACGACTTCGTAATGAAGAGAGAATCTCG AAAGTTTGGCGACGAAGTTTATCCAGAAAATCCAAATACTGGTCTATGGT TTGATCACGAGACAGGTATGGTACACTAAAGCATAATCAGTCACGTGTTA TCGTTCAATATTTTTCAACTCGCACTCGATATTTCGATACAATAAAACGT GCAAAATTGATGACAGAACTGATAATTCAATTAATCTCGTTGCACGTGGT CAAAAAATGATTGAATCTTAAGAGTGTTCTGTTTTTTATAAGAATAAAAT GTTAACGAAACTTATCCTCAGGTTGGCGAATCCGATATATTTGAAACTGA TAAATTTCACATTTCACATAATTTCAATAGTTTACGTTGATGTCATGATA AAACTGAAAATTCAAGTATGCTTCGATGATCATTGATAATTTTGTTGATA AATTCCTCGAGATCCAGCAAATCTAAGCTATCTACACTTGTGATTGAGAT AAGCTTCTGAAAGTCGAACGATTATAAAAAATTGTATAAACACAAGGAAA TATCATCACGTACAGTAACCACTTCATGAATTATGGATCTCTGCATGTTT GGAGTATATCAAAACATTGATAAACCGTCTCGACCGTACTGTTTAATAAT GATAAATCTTCTTCGCTTGATAAATCGAGCTCAAAAAATAACATTTTTCG TCGCGAGATCCCACTAAACTTTTTTGTGAATTCTGTCATTTATGGCACGT ATGAATAATCAGTAATCTGATCCATTCATTCCTTTCTCAGTTTTATAGAT TTCTTTTACTACATCCAATGGACACCACTTATTTTATTACAAGTTGAATC TTTTTAAAAAATTGGAATTTAAAATAGGACAACTTTGTTGAAATATCTGT AATTTATTTCCTGTCAGTTAAAACGAAAATAATTAGACGAAAAATATATC ATTGCCACTGTAAAATCCAACGAAATTTTAATTTTTTCTCATCTTCATCG TGCAGACAATTCGTTCTGGTATGAAGACGCCCAGATAGTACTCAAGAAAA AGCTTCAAAGGAGCCTAAACACAGGAGTCGCTAAAAATGTGATTGTATTT TTGGGCGACGGAATGTCAATTCCGACGTTGATGGCGACCAGAACGTACCT GGGACAACTCGAGGGCAAACCGGGCGAGGAAGGCTCTCTTTATTGGGAAC ATTTTCCTTACACCGGTCTTTCGAAAGTATAATAAAAAATTCTTATTTCC TTACTGAAGTTTAGAAATTATAGCACGACCAACTTTAAGATGATTACGTG CAACTTATTGAAATTTGAATTGTAAACTTCCATCTATTAATGTTATTGAA TGATTCAAATATACAAAACGTCATTAGACATGGTGCCTCGACAAACAAGT GCCGGATTCTGCTTGTACCAGCACGGCGTATCTTGGGGGTGTCAAAACAA AGTCAGGAACAATTGGTCTCAATGGAAACGTTGTTCGTGGCAAATGCGAA ACTCAAATCAAGGAAAATCATGTTGACTCGATCGCTCAGTGGGCTCAAGA TCACGGCAAAGGAACCGGAATTGTCACCACAACAAGGATAACCCACGCTT CGCCAGGTGGAGCTTACGCCCACGTTGCAGAGAGACACTGGGAAAGCGAT AGCGATGTGATTATCGGGGGTTACGATCCCAAGGAGTGTGATGATATAGC CAAACAACTTGTTCGCTCGAGTCCTGGCAACAACTTCAAGGTATTTTGAT TTCGCAAGTATTCTACTATAGAGCAATTTCAAAATCGATGGTAGCATCTC CCGTAGTAAAGTATATCTATATATGGGGCATTCCACGTCAAATCAGCCAC TTCAAAACTTTTGAATTTTTTATTTGGTTCAAAATTTTTCAGTTTGTTAT ACCCATTGAAAGGAGTTCTCTTGATTTTTTCCAGAATTTTTAGTCGATTG GATAGTAAATTATGATTTTTGGAAAAAAATANNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTAACTTTCCGAAAAGTAGGCCGAATTCAACTT TTTTTTTTAAACTTGAGTGTTTTATTCTGTTCTTTTCGAAGATATTTTTA AAAAAATGATTGGTGTAGATTTTAATCAATTTTTCGCAGTTTTAAGCAAA AACCCATTAATTTCAAGCAATACGACAGTTTCAATTTTTTTCAAAAAATT CTCAAACAAACTTCAACTAATCCAACGATTTTTAAGACTAGTTGCGTTAT GGGATCTCGTTTGGTTATATTTTTTTCGTAATTTTGAAAAAAAAATTCAC GAATAAAATCTTAGTTTTAGACCTGGACATTCAACCAAAAGTGATGTTTC ATACGTGCAATACCATAGCAGTTAGAAAAGTTTAAAAGAGAAGGTAGTCA TAAGCCATTGATGAGAGGGGAACTGTAGGTGGAACAGTTCCGATCTGGCG AGATCGTTGTTGCAATCCCTTTGGATTGAAGAGGCACTACAAAAAAAAAA CGATTTACGATCGGCATCCGAGGATGCTAAAAAAAAACTTGGTTTAAGTA AGACCCATCAACTGTGCTCTATTTTTTGGCATAGAATATTTCTAATGATC GTTGATAGCGGGTTAATACTATGATGATAGTGACAACGTTGAGATTGAAA TAACATTAGGTAAGCAATCCTTACTTAAACCAAGTTTTTTTTGAGCATCC TCGAATGCCGATCGTAAATCGTTTATTTTGTAGTGCCTCTTCAACCCAAA AGGATTACAACAACGATCTCGTCAGATCGGAACTGTCCCACCGATAGTTT CCATCGCATCAATGGCTTATGACTATACCTTCTCTATTAAACTTTTCGAA CTGCTAATCACCACCTCGCTTGTAGTCAAATAGGATCTGTAATTCAAAAT GGTATTGCACGAATGAAACATCACTTTTGGTTGAATGTCCAGGCCTAAAA CTAATATTTTATTAGTGAATTTTTTTTCGAAATTATGAAAAAAAATATAA CCAAATGAGATCCCATAACGCAATTAGTCTTAAAAATCGTTGATTAGTTG AAGGTTTTTTGAGAATTTTTTGAAAAAAATTGAAACTGTCTTATTGCCTG AAATTAATGGGTTTTTGCTTAAAACTGCGAAAAATTGATTAAAATCTACA CCAATAATTTTTTTTAAAATATCTTCGAAAAGAACAGAATAAAACACTCA AGTTTAAAAAAAAAAGTTGAATTCGGCCTACTTTTCGGAAAGTTATAGGG AAAAGAAAAAAAATCTCGATTTTTTTCCAAAAATCATAACTTACTATCCA ATCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTATAAC AATCTGAAAAATTTTGAACCAAATCAAAAATCCAAAAGTTTTGAAGTGGC TGATTTGACGTGGAATGCCCCATATATAGGGGAGACCGGGGCAAAACGGG ATACCTAAGGAAATATTGAACTTTTCAGAAGTTTGGGAAGTTCTGTCTAT TTGTTACTCCCAAAAACTAAGAAATGTACTGGAATTTTGTTAAATTTTCA AAAAAAAAAAAAATCCGAGGCAAAACGGGGTTCCCCTCAAAAACGCATGA AATTTTTTTACTATGATTTTAATTCAATGCACCTTGGGTGTATTTTACAC CCGTAACCAAGTGCTTCCGACTTACCGCTGTAAGCGTTGAAAGCGATCTC AGCGCTTACAACGCTCTAACGTACGTCGAACGCACCCCCTGTAATTTAAT TCAAAATTAATTATATGAATAATAACGAAGATTGCCAATGTTTATTTTGT AAAAATTTGTATTCTTTATCCACTGAATCATGGATTCAGTGCCAAAATTG TGCAGAGTGGGCACATGATTCATGTGCAGGTGTAATCACACATGATGGTC CGCAAACATATATCTGCGATTACTGTCGTAGACAGTAATCTGCGAGGCAG TAATCGCAGATTTACAAATACTTTTTGTATATCTGTGCAAAAACGTTTTC ATTTTAAAAGTGATGTAAAAAAAAGAGAATTTGAAAAAAACGAATTGTTT GAAAAAAAAATCAAAATCCAAAAAAAAACAAGATATTTTGGAAAAAATAT GTTTCATGTTTTTTTCGGACTAGGATAAAAATTTAAAAAAAAGACAAAAA AATTTCTCTCATTTTCCGGGTATCCCGTTTTGCCCCGGTCTCCCCTATCA TAAATACAGTCGCTGTCACATGTCAAACGCCTCTCGTGTATTCTACCGGA TTTCTCTGTGAGTTTTTATTGAAATCGTGACAAATAAATTTTGTAATGAG CAGGAAAGTGGTGTGAATCCGGCTCTGATCTCTTCGGGTGTGGCATATGC GTGTACAATTTGTGATAAAATAATCTTTGCGACCGGCGTAAAAGGTGTCA TGGCGTACGCAAACTGCTTCGTATTTTTATTTATTCATTGCGTTGGTGAG AAAAATCTGCTGTCATCTGCTGTCAAAATCAGCCGGAATCAACTAATTAA ATCACATTTTTGGATATTTTTTATATTTGCGTAATCAAGAGACGCGGTAG CGGCTCGACGCCATTAAGGAGGCTCGGTCGCGAATGCCTGCGCAACAGAA AAAAATAATTTTTTAATATCTCATAGTTAGATTATCAATAATGACATGTG CAAAATTTCAGATGGGGTCATCGACCATTTAAGAACGAAAAAAATAGTGA AAGTTAGGATTTTTAACACGGGTCTTATGGAAGAGTCACTCTCAAAACGC GTGTCCTAAGGGATATATATGCACTTACGCAACAGAAATAAACAAAAAAA TAAAGTATTGTTCTCCAAATCGTAAGGATTCAGATTATATCAAAAAAGTT TGGAGTTATCGACCTATCTAAAAAGATATTGACTGTTAAAATGTCTACAA ACTCGATGTTCTGGGAGGTTTCGTGACGGTCAGACGATTCCGCAACGTCG CAGAAATCAGATGTTCAGCACAGTGCTGAAGCGCATGCGCGATATTTGAA GCATCGACTGTCTAACCTGGAATTTGTGAAAAACACACGCACGTCCGGGC GTGTGTAGACGCGTACATAGAGGTTAAAAAACGAATTAATTGTATAAAAA CGTCAAGTTTTAACGATTAACACAATTTATATATTTATTTTCCAACAATA ATAAATAATGTTATATATCACAGGTAATGAGACCGAAAAAAAATCGTAAT AGATCGTTGAGTATTTCTGTATGAAATCAAGTAATTTTCAGCTGTTCAAT TATTTTCTCTATATTTCGAAGTTGTCACTTTTTTGTGAGCAGGATCGTAA CGTCAAACTGTACTTTTTTTCTGTTCTTTTTTTATTGATGTGCGACTGTT TATTTCTGTTTTAAATGATTAATAATCGTTTTATAATGCATTGTGGTAAT GCAAATATGCGCATTTAAAAAAAAAACTGGGTGGCCCGTTTATGCACCCA CAAAACCCGGCCCTACGCGACCGAGCTTCCTTAAAATCGTTATATTCGCG ACAAAATCTGATAGAGACGGATTTTAGTTTGATTTTTGGACACTTGGCAC TGCGTATGCTTCGATGATTCTTGATTCATTCGAATTTTTATGAAAACAAA GAACAAAATTGGTTCAATTCTAAGTGGGCCCAAATAAAATGAGCTCAAAC GCGAATACAATCGAGAAAGAATTTCGAAATTCCTCAACTTTTTTTCTTTA TTTCGAATATAATGAAAGCTTGCATCTGAGGTCCTCAGTGAAAAATAATG AGCAACACTAGATAAAGAAAATGAAGAAACAATTGAAGCGTCAATGTGTT TTTCATTGAGAAACACAAAAGTTATTTTATCAAATGAATTTTGTCAAAGG TGGTTTTGGGAGGAGGTCGCCGATCATTCCTGCCAAAGGAAATTATCGAC GAGGAGGGTGACGCAGGTGTACGTTCGGACGGAAAAAATTTGATCGATGA ATGGAAAAAAGATAAAATGGAGCGTAATGGAAGACCCATTTATTTATGGA ACCGTACGTCATTGCACGAGATTATCGATTATCCGGAAAAATACGACCAC GTGCTGGGTCTTTTCGAGTCTAGTCACTGCCACTATCATCTCGAGGGCTC GCCCGAAACTGAGCCAACGTTAGCTGAAATGACCGAGGCAGCGATCAGAG TACTTCAAAAAGATGAAAATGGATTTTTCCTCTTCGTTGAAGGTGCTCCC TGCATTATTAATTTATCATCACGAATGCACTTCTTTAACGACTTTTTTTC CAATCGACAATCGGGGCTTAGCTAACAGAGATGCAGAAGCTTTTTCATTG CGAGTTTTATGCTTATTTTTTCTCCATCCCCAATGGTCGGAGCCATAATT ACAATAAAGAGAAGCGCTTTGTCCAATGACTAGCTCCTCGAAAGGAGATC TGATAAAAAATACCATCCGTTTCTTCGACTCACGATATTCAATCCTGATC CCAAGTTCAAATTCATACCCAAGCGAGCTTTGCGACATCAGCTCATTGAT TCATTTACTATTTGGTATACATAAAAAAAACAGGGTTATTTATTGTTATG TCCGAGTAGTCGACCTCAGTTTCTAAATTTTTTCAAAAAGAACTCCGATA AGTAAAATAGAACAGGTTGATCTCAAAGGTAAATTTAAAGGATACTCGAC CCTGGTCTGCTTTCATTATTTTTCGCACTAGCATCGGAACTCTCGATACG AATGTTTTCATCGTGATTTTTGTGTATGTTATATATAAAACGATGATAAA TCCTTCAGGATACCGGTGAGAAAAAAAACAGATAGATCGGCAACGTTGAG AAAATATTGATTTTTCAGGTGGTCGAATCGATCATGCTCATCACAACACA TTCGCGACACTGGCTCTCGACGAGACAGTAGAACTTGCTAAGGCTGTTGA GAGAGCAACGGAGTTAACGTCAGAGAAGGATACACTTATCATTACAACTT CGGATCATGCACACACGATGTCAGTTTCCGGTTACCCGAAGAGAGGCAAT CCGATCAATGATATCGTTGGAAAAATGGCTAAAGATGACATTCCATATGC GACGCTGACATACGCCAATGGTCCAGGTTACAGACCACCCAATCAGGATG GTTCTCGATACGATCCATCTGAGGGCGATTTTGGTAAGGAAAAACAATTT GTTCATTTCGTCAATTCGAGAATTGGACGAATTATTACAGGCTACATAAT GAATATGAACATAACATAAATTTATCTACCTAAGAGATCTACTCATTTTT CCTAAACACTCTTTTTTTAGGAATTTTGGATACACGATTTAATAAATCAC TTTACATAAACATTCGTGGAATTCGTGGTTTTATATGAAATGCATTCAAG CGTTCAGAGGAATTAAAAAAAACGATGGCATATTCTAAAAAAATCATGTG GATTCAGAATGATAAGCAAAAAAATAAGAACCAAAATAAATGTGTAACAC AGATAAGGTTAATTCTTGTACTGAGACAAAAAAGATATTCAACGTAATGG CAAAAATTTCGAAACCTGCTTAGTTTTCCAGACTTTTCATTATCGAATTG CCACCAAAAGTGTCTCAATCTCTCACTAATCTCTTATTTATCGTAAAAAC GAAAGAAACAGTGCACATTTTAACTTTATATACAATCTTTTACGAAAAAA AATTAATAATAAAATGATTAAAGTGATTTTTTGCCCAGTTGAAGAGTTTA CTTCCGGAATAAGAATTCGTACGGATCCAGAGTTAACATGATTCGGTCAT GTCCTTGAAGCGGAAACATTCCTTTTTGATGAAAAATTATTCTGTTGAAT AAAATTAGCATTTTGACTACTTTCAGAAAATCCTCGTCACATGTCCCCTG CTCTGGCTCCACTCGATTCCGAGACTCATGGCGGCGATGACGTAGCGATT TTTGCGAATGGCCCATGGGCTCATCTATTCACCGGAACAATACAACAAAG CAACATTCCACATTTTATCGGTTTCGCGTCCTGCATAGGCAAAGGTGAAT CAGATGCGTGCAAATTGAATCGTCGGTTCGCTTCCAAGCTGCCCAAATTT CATTGA
back to top

Coding sequence (CDS) from alignment at scaffold_1299:29157..37312-

>g17100.t1 ID=g17100.t1|Name=g17100.t1|organism=Venturia canescens|type=CDS|length=1587bp|location=Sequence derived from alignment at scaffold_1299:29157..37312- (Venturia canescens)
ATGATGGACCGAAAAATGCACGACGACTTCGTAATGAAGAGAGAATCTCG
AAAGTTTGGCGACGAAGTTTATCCAGAAAATCCAAATACTGGTCTATGGT
TTGATCACGAGACAGACAATTCGTTCTGGTATGAAGACGCCCAGATAGTA
CTCAAGAAAAAGCTTCAAAGGAGCCTAAACACAGGAGTCGCTAAAAATGT
GATTGTATTTTTGGGCGACGGAATGTCAATTCCGACGTTGATGGCGACCA
GAACGTACCTGGGACAACTCGAGGGCAAACCGGGCGAGGAAGGCTCTCTT
TATTGGGAACATTTTCCTTACACCGGTCTTTCGAAAACATGGTGCCTCGA
CAAACAAGTGCCGGATTCTGCTTGTACCAGCACGGCGTATCTTGGGGGTG
TCAAAACAAAGTCAGGAACAATTGGTCTCAATGGAAACGTTGTTCGTGGC
AAATGCGAAACTCAAATCAAGGAAAATCATGTTGACTCGATCGCTCAGTG
GGCTCAAGATCACGGCAAAGGAACCGGAATTGTCACCACAACAAGGATAA
CCCACGCTTCGCCAGGTGGAGCTTACGCCCACGTTGCAGAGAGACACTGG
GAAAGCGATAGCGATGTGATTATCGGGGGTTACGATCCCAAGGAGTGTGA
TGATATAGCCAAACAACTTGTTCGCTCGAGTCCTGGCAACAACTTCAAGG
TGGTTTTGGGAGGAGGTCGCCGATCATTCCTGCCAAAGGAAATTATCGAC
GAGGAGGGTGACGCAGGTGTACGTTCGGACGGAAAAAATTTGATCGATGA
ATGGAAAAAAGATAAAATGGAGCGTAATGGAAGACCCATTTATTTATGGA
ACCGTACGTCATTGCACGAGATTATCGATTATCCGGAAAAATACGACCAC
GTGCTGGGTCTTTTCGAGTCTAGTCACTGCCACTATCATCTCGAGGGCTC
GCCCGAAACTGAGCCAACGTTAGCTGAAATGACCGAGGCAGCGATCAGAG
TACTTCAAAAAGATGAAAATGGATTTTTCCTCTTCGTTGAAGGTGGTCGA
ATCGATCATGCTCATCACAACACATTCGCGACACTGGCTCTCGACGAGAC
AGTAGAACTTGCTAAGGCTGTTGAGAGAGCAACGGAGTTAACGTCAGAGA
AGGATACACTTATCATTACAACTTCGGATCATGCACACACGATGTCAGTT
TCCGGTTACCCGAAGAGAGGCAATCCGATCAATGATATCGTTGGAAAAAT
GGCTAAAGATGACATTCCATATGCGACGCTGACATACGCCAATGGTCCAG
GTTACAGACCACCCAATCAGGATGGTTCTCGATACGATCCATCTGAGGGC
GATTTTGAAAATCCTCGTCACATGTCCCCTGCTCTGGCTCCACTCGATTC
CGAGACTCATGGCGGCGATGACGTAGCGATTTTTGCGAATGGCCCATGGG
CTCATCTATTCACCGGAACAATACAACAAAGCAACATTCCACATTTTATC
GGTTTCGCGTCCTGCATAGGCAAAGGTGAATCAGATGCGTGCAAATTGAA
TCGTCGGTTCGCTTCCAAGCTGCCCAAATTTCATTGA
back to top