g37.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg37.t1
Unique Nameg37.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:334190..336430 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g37g37Venturia canescensgenescaffold_1 334190..336430 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g37.t1-start_codong37.t1-start_codonVenturia canescensstart_codonscaffold_1 334190..334192 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g37.t1-CDSg37.t1-CDS-1Venturia canescensCDSscaffold_1 334190..334214 +
g37.t1-CDSg37.t1-CDS-2Venturia canescensCDSscaffold_1 334359..334553 +
g37.t1-CDSg37.t1-CDS-3Venturia canescensCDSscaffold_1 335037..335474 +
g37.t1-CDSg37.t1-CDS-4Venturia canescensCDSscaffold_1 335647..335987 +
g37.t1-CDSg37.t1-CDS-5Venturia canescensCDSscaffold_1 336065..336160 +
g37.t1-CDSg37.t1-CDS-6Venturia canescensCDSscaffold_1 336266..336430 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g37.t1-exong37.t1-exon-1Venturia canescensexonscaffold_1 334190..334214 +
g37.t1-exong37.t1-exon-2Venturia canescensexonscaffold_1 334359..334553 +
g37.t1-exong37.t1-exon-3Venturia canescensexonscaffold_1 335037..335474 +
g37.t1-exong37.t1-exon-4Venturia canescensexonscaffold_1 335647..335987 +
g37.t1-exong37.t1-exon-5Venturia canescensexonscaffold_1 336065..336160 +
g37.t1-exong37.t1-exon-6Venturia canescensexonscaffold_1 336266..336430 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g37.t1-introng37.t1-intronVenturia canescensintronscaffold_1 336161..336265 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g37.t1-stop_codong37.t1-stop_codonVenturia canescensstop_codonscaffold_1 336428..336430 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g37.t1g37.t1-PAVenturia canescenspolypeptidescaffold_1 334190..336430 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g37.t1 ID=g37.t1|Name=g37.t1|organism=Venturia canescens|type=mRNA|length=1260bp|location=Sequence derived from alignment at scaffold_1:334190..336430+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGAGCGGCGGTGTTTATGGCGGAGATGAAGTCGGTGCGATTATATTCGA
CGTTGGACATCAGAGCTTGCGAGTCGGTTATGGCGGTGAGGACAGCCCCA
AAGCAGAAATTCCTACGAGCCTCGGCGTGTGGGACGATCCCATGGAAATC
AACGAACCCGGACAACCCCCGAAAAAACGTTACAACATCGACGTCACCGC
TATTCAAGTACGGCGTAAAGATATGGAGATAGTGAGCATGATGAAAGACG
GTATGATAGAAGATTGGGACATGTTCGAGCGTCTGGCCGAATACACGTAC
AAGCAGCGTCTTCACGCATGGCCGGAGCATCACCCAATTTTGATGACCGA
ATGTCCATGGAACACGAGAGTCAAGCGAGAAAAATTGCTCGAGCTAATGT
TCGAGAAATTCAACGTTCCTGCTATGTATATTTGCAAAAATGCGGTTTTA
GCGGCTTACGCGAACGGCAGATCGACCGCGATGGTTGTCGACAGTGGTGC
CACTCACACGAGCGCGGTTCCTGTACACGACGGCTACGTCATTACTCAAG
GAATTGTCAAGAGTCCACTCGGTGGCGATTTTTTGACCATGCAATGCAGA
CAATTTTTCGAGGACAGAAACGTCGAACTCGTTCCTGCTTGTTTCGTCGC
TAGCAAAGAAATTGTACGAGAACGTGAAACTCCGCGTTGGACCCGAAAAG
CTGGTCCAACACCAACGTCTTCCTGGCTGTCGTACATGGTGCGTGAGCTC
ATTCAAGATTTCCAGATGAATTGTCTCCAAGTTTCCGACGGGCCTTACGA
CGAGGACATGGCGAGTGCGTTGCCAATGAAACGATACGAATTTCCAACGG
GCTATAACGACGATTACGGTTCTATAAGGTTGATGATTCCCGAAGCGCTT
TTCGATCCGAGCAACGTGAAAGGCGTTGGTGCGAGTATCCTCGGCGTTGG
ACCACTCGTTACTACGAGTGTTGGCATGTGTGATATGGACGTTCGACCGA
GCTTGTACGGAAGCGTGGTCGTGACGGGAGGAAATTCTTGTCTCCAAGGC
TTCAGCGATCGTCTCAACAGGGATTTAATCACTAAAACACCGCCGAGCAT
GAGGCTGAAGATAATCAGCGCGAACAGCTCGAGCGAGAGGCGTTACGGAG
CTTGGATTGGCGGTTCAATATTAAGCTCACTCGGATCGTTCCAACAAATG
TGGCTCTCGCGACAAGAATACGAGGAATCAGGTAAGCTCATACTCGACAG
ATGCGCTTAG
back to top

protein sequence of g37.t1

>g37.t1-PA ID=g37.t1-PA|Name=g37.t1|organism=Venturia canescens|type=polypeptide|length=419bp
MSGGVYGGDEVGAIIFDVGHQSLRVGYGGEDSPKAEIPTSLGVWDDPMEI
NEPGQPPKKRYNIDVTAIQVRRKDMEIVSMMKDGMIEDWDMFERLAEYTY
KQRLHAWPEHHPILMTECPWNTRVKREKLLELMFEKFNVPAMYICKNAVL
AAYANGRSTAMVVDSGATHTSAVPVHDGYVITQGIVKSPLGGDFLTMQCR
QFFEDRNVELVPACFVASKEIVRERETPRWTRKAGPTPTSSWLSYMVREL
IQDFQMNCLQVSDGPYDEDMASALPMKRYEFPTGYNDDYGSIRLMIPEAL
FDPSNVKGVGASILGVGPLVTTSVGMCDMDVRPSLYGSVVVTGGNSCLQG
FSDRLNRDLITKTPPSMRLKIISANSSSERRYGAWIGGSILSSLGSFQQM
WLSRQEYEESGKLILDRCA
back to top

mRNA from alignment at scaffold_1:334190..336430+

Legend: start_codonpolypeptideCDSexonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g37.t1 ID=g37.t1|Name=g37.t1|organism=Venturia canescens|type=mRNA|length=2241bp|location=Sequence derived from alignment at scaffold_1:334190..336430+ (Venturia canescens)
ATGAGCGGCGGTGTTTATGGCGGAGGTAAAAGCCGGTGTTTTTTATTTTT CCCTCATTTTAATTAATACGACAAAAGTTGAAGATACAAGATAGAACGAC GCGAATGCGAACGAATCGTTCGTACGTGATACAATAGTTTTTATCTTATT ATTCCACTTTTCCGTGCAGATGAAGTCGGTGCGATTATATTCGACGTTGG ACATCAGAGCTTGCGAGTCGGTTATGGCGGTGAGGACAGCCCCAAAGCAG AAATTCCTACGAGCCTCGGCGTGTGGGACGATCCCATGGAAATCAACGAA CCCGGACAACCCCCGAAAAAACGTTACAACATCGACGTCACCGCTATTCA AGTACGGCGTAAAGGTACAAACAATCGTTATTACGTTTTCGAACTTCCGG TTGTTTTGACACACGTATTCGTTTGATAATGTAAACAAGGCGTATTGAGG ATTGAATTTTTTCTTCAGGAATAAATGAGATTTTTTTCAAGAAATTCAAA AATTTTGAATTAAAACTCTTTTGGAGCAAAACCACCATGACAAAAATAGT GGAAAAACGAAATAAAAATGGAAGCTCAATAATCTGATAGTTTTAACGTG TCATAATTGCAACAATAAAATTAATTTTATGATATACCAACGTTTAAAAA CCCAAAAAGACTTAAATAAATTTATAGCATCACTGAAGAATCAATCACTT GAAAGATTGAAGCTGAAAACAGCACCAAAATTGTAGACTGATTTTTTTTT TTTTAAATATCAAATGCAATTTCTCAATTTCAATTTTTATAATTCTCGTG GATTTATCGTTTTTTAACGGATTTTCAAATTTTTTCACTTTCTTCAGATA TGGAGATAGTGAGCATGATGAAAGACGGTATGATAGAAGATTGGGACATG TTCGAGCGTCTGGCCGAATACACGTACAAGCAGCGTCTTCACGCATGGCC GGAGCATCACCCAATTTTGATGACCGAATGTCCATGGAACACGAGAGTCA AGCGAGAAAAATTGCTCGAGCTAATGTTCGAGAAATTCAACGTTCCTGCT ATGTATATTTGCAAAAATGCGGTTTTAGCGGCTTACGCGAACGGCAGATC GACCGCGATGGTTGTCGACAGTGGTGCCACTCACACGAGCGCGGTTCCTG TACACGACGGCTACGTCATTACTCAAGGAATTGTCAAGAGTCCACTCGGT GGCGATTTTTTGACCATGCAATGCAGACAATTTTTCGAGGACAGAAACGT CGAACTCGTTCCTGCTTGTTTCGTCGCTAGCAAAGGTTTTCAAACTTCAT TGAAATCCCATTTCCTTTCATAAACTTTCTTTCAACTTCTTCATCTAACG TGCTCGAAATTGGACTTTTTGGTGGTTTTTTTTTGCAGTTCCAAGATTTT TTGTTTTCATTTTTACAAAGGAAAGGAATGTTCGTGAAATTAAAAAATTT TTTTCAGAAATTGTACGAGAACGTGAAACTCCGCGTTGGACCCGAAAAGC TGGTCCAACACCAACGTCTTCCTGGCTGTCGTACATGGTGCGTGAGCTCA TTCAAGATTTCCAGATGAATTGTCTCCAAGTTTCCGACGGGCCTTACGAC GAGGACATGGCGAGTGCGTTGCCAATGAAACGATACGAATTTCCAACGGG CTATAACGACGATTACGGTTCTATAAGGTTGATGATTCCCGAAGCGCTTT TCGATCCGAGCAACGTGAAAGGCGTTGGTGCGAGTATCCTCGGCGTTGGA CCACTCGTTACTACGAGTGTTGGCATGTGTGATATGGACGTTCGACCGGT AAACCAATAAATCGAATAAAACCTGAAAAAAAATATTGAAAATAATAATA AGCCATATTTTTAAATTATTTTCAGAGCTTGTACGGAAGCGTGGTCGTGA CGGGAGGAAATTCTTGTCTCCAAGGCTTCAGCGATCGTCTCAACAGGGAT TTAATCACTAAAACACCGCCGGTAATAATTTTGCAACTCGCAATTAATCT TTGAATTAGAAAACGTTAAAAGATCTTTTGAACTTTGTCAATTTGAACTC GTTTCACGATAACAATTCGATGGCAGAGCATGAGGCTGAAGATAATCAGC GCGAACAGCTCGAGCGAGAGGCGTTACGGAGCTTGGATTGGCGGTTCAAT ATTAAGCTCACTCGGATCGTTCCAACAAATGTGGCTCTCGCGACAAGAAT ACGAGGAATCAGGTAAGCTCATACTCGACAGATGCGCTTAG
back to top

Coding sequence (CDS) from alignment at scaffold_1:334190..336430+

>g37.t1 ID=g37.t1|Name=g37.t1|organism=Venturia canescens|type=CDS|length=1260bp|location=Sequence derived from alignment at scaffold_1:334190..336430+ (Venturia canescens)
ATGAGCGGCGGTGTTTATGGCGGAGATGAAGTCGGTGCGATTATATTCGA
CGTTGGACATCAGAGCTTGCGAGTCGGTTATGGCGGTGAGGACAGCCCCA
AAGCAGAAATTCCTACGAGCCTCGGCGTGTGGGACGATCCCATGGAAATC
AACGAACCCGGACAACCCCCGAAAAAACGTTACAACATCGACGTCACCGC
TATTCAAGTACGGCGTAAAGATATGGAGATAGTGAGCATGATGAAAGACG
GTATGATAGAAGATTGGGACATGTTCGAGCGTCTGGCCGAATACACGTAC
AAGCAGCGTCTTCACGCATGGCCGGAGCATCACCCAATTTTGATGACCGA
ATGTCCATGGAACACGAGAGTCAAGCGAGAAAAATTGCTCGAGCTAATGT
TCGAGAAATTCAACGTTCCTGCTATGTATATTTGCAAAAATGCGGTTTTA
GCGGCTTACGCGAACGGCAGATCGACCGCGATGGTTGTCGACAGTGGTGC
CACTCACACGAGCGCGGTTCCTGTACACGACGGCTACGTCATTACTCAAG
GAATTGTCAAGAGTCCACTCGGTGGCGATTTTTTGACCATGCAATGCAGA
CAATTTTTCGAGGACAGAAACGTCGAACTCGTTCCTGCTTGTTTCGTCGC
TAGCAAAGAAATTGTACGAGAACGTGAAACTCCGCGTTGGACCCGAAAAG
CTGGTCCAACACCAACGTCTTCCTGGCTGTCGTACATGGTGCGTGAGCTC
ATTCAAGATTTCCAGATGAATTGTCTCCAAGTTTCCGACGGGCCTTACGA
CGAGGACATGGCGAGTGCGTTGCCAATGAAACGATACGAATTTCCAACGG
GCTATAACGACGATTACGGTTCTATAAGGTTGATGATTCCCGAAGCGCTT
TTCGATCCGAGCAACGTGAAAGGCGTTGGTGCGAGTATCCTCGGCGTTGG
ACCACTCGTTACTACGAGTGTTGGCATGTGTGATATGGACGTTCGACCGA
GCTTGTACGGAAGCGTGGTCGTGACGGGAGGAAATTCTTGTCTCCAAGGC
TTCAGCGATCGTCTCAACAGGGATTTAATCACTAAAACACCGCCGAGCAT
GAGGCTGAAGATAATCAGCGCGAACAGCTCGAGCGAGAGGCGTTACGGAG
CTTGGATTGGCGGTTCAATATTAAGCTCACTCGGATCGTTCCAACAAATG
TGGCTCTCGCGACAAGAATACGAGGAATCAGGTAAGCTCATACTCGACAG
ATGCGCTTAG
back to top