g38.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg38.t1
Unique Nameg38.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:337539..341974 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g38g38Venturia canescensgenescaffold_1 337539..341974 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g38.t1g38.t1-PAVenturia canescenspolypeptidescaffold_1 337539..341974 -


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g38.t1-stop_codong38.t1-stop_codonVenturia canescensstop_codonscaffold_1 337539..337541 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g38.t1-CDSg38.t1-CDS-7Venturia canescensCDSscaffold_1 337539..337670 -
g38.t1-CDSg38.t1-CDS-6Venturia canescensCDSscaffold_1 337864..338004 -
g38.t1-CDSg38.t1-CDS-5Venturia canescensCDSscaffold_1 338150..338299 -
g38.t1-CDSg38.t1-CDS-4Venturia canescensCDSscaffold_1 338461..338953 -
g38.t1-CDSg38.t1-CDS-3Venturia canescensCDSscaffold_1 339186..339337 -
g38.t1-CDSg38.t1-CDS-2Venturia canescensCDSscaffold_1 339438..339589 -
g38.t1-CDSg38.t1-CDS-1Venturia canescensCDSscaffold_1 341956..341974 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g38.t1-exong38.t1-exon-7Venturia canescensexonscaffold_1 337539..337670 -
g38.t1-exong38.t1-exon-6Venturia canescensexonscaffold_1 337864..338004 -
g38.t1-exong38.t1-exon-5Venturia canescensexonscaffold_1 338150..338299 -
g38.t1-exong38.t1-exon-4Venturia canescensexonscaffold_1 338461..338953 -
g38.t1-exong38.t1-exon-3Venturia canescensexonscaffold_1 339186..339337 -
g38.t1-exong38.t1-exon-2Venturia canescensexonscaffold_1 339438..339589 -
g38.t1-exong38.t1-exon-1Venturia canescensexonscaffold_1 341956..341974 -


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g38.t1-introng38.t1-intronVenturia canescensintronscaffold_1 339590..341955 -


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g38.t1-start_codong38.t1-start_codonVenturia canescensstart_codonscaffold_1 341972..341974 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g38.t1 ID=g38.t1|Name=g38.t1|organism=Venturia canescens|type=mRNA|length=1239bp|location=Sequence derived from alignment at scaffold_1:337539..341974- (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGGATATCCCGTCACAAGAGAGCGATACAAAATCGCAGGAACGTGAAGC
TAAAATAGCGAGATGGCGAAATATAATTGCCTTTTGGTTGCTCGGACTGT
GCAACAATTATGGCTACGTTGTGATGCTGAGCGCCGCACACGACATTCTG
GAAGCGAAATTCAGCGACCATAAGCACACAGAGACAGCGGTCGTTAACGC
AACCATAGCGGATCCTACGTCACGTCAATGCAACGCAGTATCGACGGGAG
CTATTTTGCTGGCAGATATATTGCCTTCTTTGACTATCAAACTATTAGCA
CCATTTTTGCCATTTTTTGTCAACGTCCGGATGGCCACGTGTGTGGGATT
ATCGATACTGAGCTTCCTGGCAGTTTCGTTTGGCCAGGTCCAATGGGTGA
CGATAATGGGGGTCGTGTTGACGTCTCTTTCCTCAGGATTCGGTGAGGCA
ACGATAATAAGTCTCGGTCATAAGTACGGAAGGGATGGAATAGCGGCGTG
GTCATCCGGCACCGGGGGTGCTGGGATAGTCGGTGCATTTTCTTACGCCG
CTCTGAGGGTCGTGATGTCAACCGAACAAGCACTTCTGGTCATGCTCGTC
GTACCGGTTGCCCAGGCTGCTGCGTTTTGGCTCGTCATGATCGAACCCCA
CGAGAGTACTTTAGTGGCGAAGTACGCTCTCGAGAGTCAAGAAGAAATAA
TAAAAGCTCCTAACAAAACTCTCCGTGAGAAATTCGCCCTGGTACCGACG
GTCATCAAATACATCGTGCCACTCGGGCTCGTTTATCTTTTCGAGTATTT
CATCAATCAGGGATTGTACGAGTTGATCCAATTCGATAATATTTGGTTGA
CGCACGAAGACCAATATCGATGGCTCCAAGCAGACTATCAAATCGGAGTT
TTTATTTCACGCTCCTCCGCTGGATTCGTCACGTTCAAACGAATTTGGCT
CATGGCTCTTTTCCAGTTTATCAACGTCATTCTCTTCCTGACCGAGAGCA
TTTTCTATTATATTCCAAACATCTGGATCGTTTTTATCCTCGTTCTGTGG
GAAGGTCTTCTCGGCGGTGGTGCTTACGTTAATACGTTCTACAAAATGAC
AGACGAGGTACCATCGAACGATCTCAAAGTTTCACTGGGAATCGTGAGCA
TGTCCGACTCGTTGGGAATTGCTTTGTCTGGATGGATATCGATAGTGGCG
CACACAGCAATATGCAAATTACCGAAATCAGTTCGATGA
back to top

protein sequence of g38.t1

>g38.t1-PA ID=g38.t1-PA|Name=g38.t1|organism=Venturia canescens|type=polypeptide|length=412bp
MDIPSQESDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDIL
EAKFSDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLA
PFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEA
TIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLV
VPVAQAAAFWLVMIEPHESTLVAKYALESQEEIIKAPNKTLREKFALVPT
VIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGV
FISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLW
EGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVA
HTAICKLPKSVR
back to top

mRNA from alignment at scaffold_1:337539..341974-

Legend: polypeptideCDSexonstart_codonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g38.t1 ID=g38.t1|Name=g38.t1|organism=Venturia canescens|type=mRNA|length=4436bp|location=Sequence derived from alignment at scaffold_1:337539..341974- (Venturia canescens)
ATGGATATCCCGTCACAAGGTACAGTGAATTTTCGTACTTACGAGAAAAA GTAACAAAACGAAAAAAAATTAACAAATTATGGACTCGACGCGTTATTTC AAACTCGCACACTGAGCTGATAATTTTTTATCGTTTTTAGAGTCATAAAT AGTCGCTACGAAGTCTCCATGTCTAATTGTTCCACCAGAGATACAAATTA TCTTCACCAAAAAAATAAAACTTTCATCTAATTAGTTATTTTGAATTTTT TTTTCAAGCCCTCATCAATTTTCAAAGATAAAGCACACGTGCGTCAGTAT ATTCTCAGCTAGAAAATTATGACAACGTTTTCCGCTCGAAGTGCTATCAT CAAATTTCCTTAACAGTTGTGTAAACACTCACGCATACATACACACGTAA ATAAAGCTACCAAATATTCGTAAATGAATCGTGAATCGTTCTGCTTAGCA GACAACTTTTTTTCGTATTATTCCATTAATACAAACACTTAAAAGACGAT TTACTCGTTCCTTCGTACAAGCAACAGTGATGAATATCATTGATCGAGGG ACCAGATAAAAAAATCTTTGTTTTAACTTCGATTAAAACGTTAATAAAGT GTCGTACAAAATCGATTTGTCGTGAGGAAATATTTCGTAAAATGGAATGT TCCTTTTCGAATACTTTTCGATCGCACGCAGGAGACGAGACGAGCACTTT TTTTAAGCTTTTACAATCTCGTATTTATTACGATCAGAAATGATTCGATC GAATCTACGATCGATTTAATAAATCGAATAATCAGTAACTTTTCACTCGA AATTCCACATTTTCTCAACTGGAAATCAATATTGACCGCCTGAGATATAT AATTGTGTTACGTTATGTAGGTCAGGTACACTGCGAGTTCAACAGCCTCG ATCCCGATTGTGAATTCGAGAAAACAAAATACATTCTGTCACCTGTTGTG TCAATAATTCGATGGCTAATCAGTCAATCTACACTTTGATCTTAACAAAC ACGTTTGATAAAAAAAATGAAGCTCGCTGGGTCGCAGAGAATTAAGCTTA TCAGGATTTGATGATTATTTGAGCGGAGATGAAAATTTTCCTCCCCAATC ACACCTACCGTCGTTAGACTCTGAAAATACTTTCGTTTAATGAATTGTAC GATTTGCGTACTATAATGATGCGATTCGAGAATGGAGCAAAAAATTAATT ATTCTCGATACAATAATCAATTTGTTATCGTAACGAAAATGATTGATTTC TCCATTGGAGTATGATACGAGAATGAAAAAAATGAAAAAAAATAATGAAA GTTCCAAATGTCCCTGTAATTATCAATCATAATTTGAAACACGCTCGACC TTGACCACACGATGCGACTTTGATATTTTCGCTCAAGTCTCATAAGCGCC TATGAAGTCGAGGTTAATGAGCATAAACACGTCGCTACTCTTGCTTATTT CGTGAGATCTATTCGCCTGCTGAATTTCAATTGTTTTTTGTTCCCAACTG TCGTTTTCTCTCGTTAAGATCGAAGGCCCCTTTTGAATTTGTGTTTTGTC GTCCGTGGCACACTTTTGAGTTCGAGGAAGAGAGAACAGTGTGATGAGGA TGTCCGGGAGCCAGAATGGACGGGCGACGATGTTCATGGGCTGAAAAAAA AACGATGCTAATGAAAAATCCAGGAAAACTCTTTGAACCTCTCAATTGAA GAAGGTTTTCTTAGGACTCTCGTATTTGACATTCGCATTTGTAAATTAAT TAACCAATTCGATTGATCAGCGTTGACGTACCACTCAATTGAGTTTAATA CTGTATTAACGTTTAATTATTTCAGTCTATTCTTGTAAATATGTTCTTGA GAATGGAAGAACCGATGATCAATCGATTATTCGAGTGTCAGTACGTTACT AATTGAAATGTATTTATGCTCGGGTGCAAAATTCATGTGGAATCGCATGC TGCGTCGTTGTTCCTCTTGCTCGAAGATTTCTTCGGATGTCTGATTATTG TAATTTTCACATCTTCATATGTAATTGAAATGTATTTATTCTCGAGCTCA AAATTCATGCTAAATTGTATCCTCCGACGTTCCTCCTCGGAGACTCTTTC GAATGATCGACGATTATAATTTTTAAAAAGACGTTTGAATCATCATTATT TTCCTATCACATTATCGGACAAGATAACGGATTATTCCACAAGGTTATTC ATTCACTGCAGAGACAATATTCTAATCGTGGAATATTTCCTCCTGCAATG AGAAAAAATGCCTTAAAAGTTGTTGCTTGACTTTGTTTCATTAATAATTT GTTTAATCACCGAATTTTCTTGCTCTCAATTTGGAATAATTTTTTGTTTT TATGTTGTAAAAAAAAACAGCTACAAAATGTGCAGAGAGCGATACAAAAT CGCAGGAACGTGAAGCTAAAATAGCGAGATGGCGAAATATAATTGCCTTT TGGTTGCTCGGACTGTGCAACAATTATGGCTACGTTGTGATGCTGAGCGC CGCACACGACATTCTGGAAGCGAAATTCAGCGACCATGTAAGTTCAGATT TGAACTCTTGACATCCCCGTTTTGCTCGGTCATTAATTTTCCTTCGGTAA TAATGGGATTAAAAACGTTTTTCCTCGTTCTGTACAGAAGCACACAGAGA CAGCGGTCGTTAACGCAACCATAGCGGATCCTACGTCACGTCAATGCAAC GCAGTATCGACGGGAGCTATTTTGCTGGCAGATATATTGCCTTCTTTGAC TATCAAACTATTAGCACCATTTTTGCCATTTTTTGTCAAGTGAGTGCCAA AATTCGAATTGCATGAAGCTCAATCTCACAATTGAGCTACGACAAACATC AAACGGTATTTGAATATAAATTCCTCTGAATATTGAATTGAATTTAATTC GCAATGATTGCTGAACCGGATTCGAATAACTTTGGATAACCGAAAATCAT TCGATTGCTTTTTGATTAAATGAAAAAAGTGATTTTTCGGTTTGTTGAGA CTTTGGAACGTCTCGTTGCAGCGTCCGGATGGCCACGTGTGTGGGATTAT CGATACTGAGCTTCCTGGCAGTTTCGTTTGGCCAGGTCCAATGGGTGACG ATAATGGGGGTCGTGTTGACGTCTCTTTCCTCAGGATTCGGTGAGGCAAC GATAATAAGTCTCGGTCATAAGTACGGAAGGGATGGAATAGCGGCGTGGT CATCCGGCACCGGGGGTGCTGGGATAGTCGGTGCATTTTCTTACGCCGCT CTGAGGGTCGTGATGTCAACCGAACAAGCACTTCTGGTCATGCTCGTCGT ACCGGTTGCCCAGGCTGCTGCGTTTTGGCTCGTCATGATCGAACCCCACG AGAGTACTTTAGTGGCGAAGTACGCTCTCGAGAGTCAAGAAGAAATAATA AAAGCTCCTAACAAAACTCTCCGTGAGAAATTCGCCCTGGTACCGACGGT CATCAAATACATCGTGCCACTCGGGCTCGTTTATCTTTTCGAGTATTTCA TCAATCAGGGATTGGTAAATATATTTCGAATAACGAGTTGCAATTACTCT CCGTTCCTTCTTTCAATTTGGCTGAAAACCTTTGCGTGAAGTTCCTTTCG CTTCGCTGCATTCTTCGAATCAGAATTTCCTCTGCTTGACCGTACTTTGT TTGACAGCATAAATAACGTTTTCAGTACGAGTTGATCCAATTCGATAATA TTTGGTTGACGCACGAAGACCAATATCGATGGCTCCAAGCAGACTATCAA ATCGGAGTTTTTATTTCACGCTCCTCCGCTGGATTCGTCACGTTCAAACG AATTTGGCTCATGGCTCTTTTCCAGGTAAAAACCAAGCGTTCTGTGCTAT CGAAACTTACGAAATTTCATGAATTTACAGTAGATTAGAAACATTTTTGA AAAGTTGCTTTTTTACTCACTTTTCTTATGATTTTTTGCTTCGAATATAA CGAATGTTTCTGTTTTTCAGTTTATCAACGTCATTCTCTTCCTGACCGAG AGCATTTTCTATTATATTCCAAACATCTGGATCGTTTTTATCCTCGTTCT GTGGGAAGGTCTTCTCGGCGGTGGTGCTTACGTTAATACGTTCTACAAAA TGACAGACGAGGTAAAAAAATGCACTCGCACTCGCAAAGTTAAATTTTTA AGTGCAAACCAAAAACTTTGAAACAGTAAAAAAATTCAACTCAATCCTTC GCGATTTCAAAGAGTCTTTTTGACAGTACTCAAAATGCTCGAATAATCAT AAAAGGCAACGATCAAATTCGTACAAAAATATTTACCATTTTTTCTCATT TCAGGTACCATCGAACGATCTCAAAGTTTCACTGGGAATCGTGAGCATGT CCGACTCGTTGGGAATTGCTTTGTCTGGATGGATATCGATAGTGGCGCAC ACAGCAATATGCAAATTACCGAAATCAGTTCGATGA
back to top

Coding sequence (CDS) from alignment at scaffold_1:337539..341974-

>g38.t1 ID=g38.t1|Name=g38.t1|organism=Venturia canescens|type=CDS|length=1239bp|location=Sequence derived from alignment at scaffold_1:337539..341974- (Venturia canescens)
ATGGATATCCCGTCACAAGAGAGCGATACAAAATCGCAGGAACGTGAAGC
TAAAATAGCGAGATGGCGAAATATAATTGCCTTTTGGTTGCTCGGACTGT
GCAACAATTATGGCTACGTTGTGATGCTGAGCGCCGCACACGACATTCTG
GAAGCGAAATTCAGCGACCATAAGCACACAGAGACAGCGGTCGTTAACGC
AACCATAGCGGATCCTACGTCACGTCAATGCAACGCAGTATCGACGGGAG
CTATTTTGCTGGCAGATATATTGCCTTCTTTGACTATCAAACTATTAGCA
CCATTTTTGCCATTTTTTGTCAACGTCCGGATGGCCACGTGTGTGGGATT
ATCGATACTGAGCTTCCTGGCAGTTTCGTTTGGCCAGGTCCAATGGGTGA
CGATAATGGGGGTCGTGTTGACGTCTCTTTCCTCAGGATTCGGTGAGGCA
ACGATAATAAGTCTCGGTCATAAGTACGGAAGGGATGGAATAGCGGCGTG
GTCATCCGGCACCGGGGGTGCTGGGATAGTCGGTGCATTTTCTTACGCCG
CTCTGAGGGTCGTGATGTCAACCGAACAAGCACTTCTGGTCATGCTCGTC
GTACCGGTTGCCCAGGCTGCTGCGTTTTGGCTCGTCATGATCGAACCCCA
CGAGAGTACTTTAGTGGCGAAGTACGCTCTCGAGAGTCAAGAAGAAATAA
TAAAAGCTCCTAACAAAACTCTCCGTGAGAAATTCGCCCTGGTACCGACG
GTCATCAAATACATCGTGCCACTCGGGCTCGTTTATCTTTTCGAGTATTT
CATCAATCAGGGATTGTACGAGTTGATCCAATTCGATAATATTTGGTTGA
CGCACGAAGACCAATATCGATGGCTCCAAGCAGACTATCAAATCGGAGTT
TTTATTTCACGCTCCTCCGCTGGATTCGTCACGTTCAAACGAATTTGGCT
CATGGCTCTTTTCCAGTTTATCAACGTCATTCTCTTCCTGACCGAGAGCA
TTTTCTATTATATTCCAAACATCTGGATCGTTTTTATCCTCGTTCTGTGG
GAAGGTCTTCTCGGCGGTGGTGCTTACGTTAATACGTTCTACAAAATGAC
AGACGAGGTACCATCGAACGATCTCAAAGTTTCACTGGGAATCGTGAGCA
TGTCCGACTCGTTGGGAATTGCTTTGTCTGGATGGATATCGATAGTGGCG
CACACAGCAATATGCAAATTACCGAAATCAGTTCGATGA
back to top