g3909.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg3909.t1
Unique Nameg3909.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_12981contigscaffold_12981:73..755 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g3909g3909Venturia canescensgenescaffold_12981 73..755 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g3909.t1-start_codong3909.t1-start_codonVenturia canescensstart_codonscaffold_12981 73..75 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g3909.t1-CDSg3909.t1-CDS-1Venturia canescensCDSscaffold_12981 73..755 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g3909.t1-exong3909.t1-exon-1Venturia canescensexonscaffold_12981 73..755 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g3909.t1g3909.t1-PAVenturia canescenspolypeptidescaffold_12981 73..755 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g3909.t1 ID=g3909.t1|Name=g3909.t1|organism=Venturia canescens|type=mRNA|length=683bp|location=Sequence derived from alignment at scaffold_12981:73..755+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGTTAGCTTTAACAAAAATAGTTCAAGAAAATGAGTCGAAAAGTGCCGT
TATTGAGGTTAGTGTGGCTCAAATACAACTTGACGTCAGAGCAATCAAGA
AAAGGGTGGAGAATCTCGAATCTAAGGATAAAATTCATAGTCCAAACACT
GAGAGCACTCGGATCGTCCAGAAGCCCAGTAAAGTAGTTTCAGATGACGA
ATCCGAGAACAAAGAGGAAAAATATGAGCCCGAAGAGAGAACGGATAGGA
TTCGGACGATGCTGCCAATGGACATGTATCCAAACAAAATAAAAATTAAA
CCTCCTACATACGATGGATCGGAAAGGAAAAGACCGATGAAGTTCATTAA
GGAGTTCCGGCGGTATTGTGAGGTGACAAatcccacaatcactgaaatga
aatatttgctgggacagtgtctcgagaaagccgcaaaagaatggtgggtt
cttattgaggaccgtgTAGAGGATTTCGAGGAAGTAGAGAAGAAATTCGT
TGAGCGTTTCTGGAGCACAGATGTCCAGAGAAAAGTGAGGAAAGACCTCG
AATTCGGACACTACTCTGATAAGGATAACAAAACATCGAAAGTGGAATAC
ACAATCAACATTTTCGGAGCCGCGAAGGATCTCATCCCTCCTCCAAGCGA
CGAGGACATAATCGCATCACTCTCGCAACATTA
back to top

protein sequence of g3909.t1

>g3909.t1-PA ID=g3909.t1-PA|Name=g3909.t1|organism=Venturia canescens|type=polypeptide|length=227bp
MLALTKIVQENESKSAVIEVSVAQIQLDVRAIKKRVENLESKDKIHSPNT
ESTRIVQKPSKVVSDDESENKEEKYEPEERTDRIRTMLPMDMYPNKIKIK
PPTYDGSERKRPMKFIKEFRRYCEVTNPTITEMKYLLGQCLEKAAKEWWV
LIEDRVEDFEEVEKKFVERFWSTDVQRKVRKDLEFGHYSDKDNKTSKVEY
TINIFGAAKDLIPPPSDEDIIASLSQH
back to top

mRNA from alignment at scaffold_12981:73..755+

Legend: start_codonpolypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g3909.t1 ID=g3909.t1|Name=g3909.t1|organism=Venturia canescens|type=mRNA|length=683bp|location=Sequence derived from alignment at scaffold_12981:73..755+ (Venturia canescens)
ATGTTAGCTTTAACAAAAATAGTTCAAGAAAATGAGTCGAAAAGTGCCGT TATTGAGGTTAGTGTGGCTCAAATACAACTTGACGTCAGAGCAATCAAGA AAAGGGTGGAGAATCTCGAATCTAAGGATAAAATTCATAGTCCAAACACT GAGAGCACTCGGATCGTCCAGAAGCCCAGTAAAGTAGTTTCAGATGACGA ATCCGAGAACAAAGAGGAAAAATATGAGCCCGAAGAGAGAACGGATAGGA TTCGGACGATGCTGCCAATGGACATGTATCCAAACAAAATAAAAATTAAA CCTCCTACATACGATGGATCGGAAAGGAAAAGACCGATGAAGTTCATTAA GGAGTTCCGGCGGTATTGTGAGGTGACAAatcccacaatcactgaaatga aatatttgctgggacagtgtctcgagaaagccgcaaaagaatggtgggtt cttattgaggaccgtgTAGAGGATTTCGAGGAAGTAGAGAAGAAATTCGT TGAGCGTTTCTGGAGCACAGATGTCCAGAGAAAAGTGAGGAAAGACCTCG AATTCGGACACTACTCTGATAAGGATAACAAAACATCGAAAGTGGAATAC ACAATCAACATTTTCGGAGCCGCGAAGGATCTCATCCCTCCTCCAAGCGA CGAGGACATAATCGCATCACTCTCGCAACATTA
back to top

Coding sequence (CDS) from alignment at scaffold_12981:73..755+

>g3909.t1 ID=g3909.t1|Name=g3909.t1|organism=Venturia canescens|type=CDS|length=683bp|location=Sequence derived from alignment at scaffold_12981:73..755+ (Venturia canescens)
ATGTTAGCTTTAACAAAAATAGTTCAAGAAAATGAGTCGAAAAGTGCCGT
TATTGAGGTTAGTGTGGCTCAAATACAACTTGACGTCAGAGCAATCAAGA
AAAGGGTGGAGAATCTCGAATCTAAGGATAAAATTCATAGTCCAAACACT
GAGAGCACTCGGATCGTCCAGAAGCCCAGTAAAGTAGTTTCAGATGACGA
ATCCGAGAACAAAGAGGAAAAATATGAGCCCGAAGAGAGAACGGATAGGA
TTCGGACGATGCTGCCAATGGACATGTATCCAAACAAAATAAAAATTAAA
CCTCCTACATACGATGGATCGGAAAGGAAAAGACCGATGAAGTTCATTAA
GGAGTTCCGGCGGTATTGTGAGGTGACAAatcccacaatcactgaaatga
aatatttgctgggacagtgtctcgagaaagccgcaaaagaatggtgggtt
cttattgaggaccgtgTAGAGGATTTCGAGGAAGTAGAGAAGAAATTCGT
TGAGCGTTTCTGGAGCACAGATGTCCAGAGAAAAGTGAGGAAAGACCTCG
AATTCGGACACTACTCTGATAAGGATAACAAAACATCGAAAGTGGAATAC
ACAATCAACATTTTCGGAGCCGCGAAGGATCTCATCCCTCCTCCAAGCGA
CGAGGACATAATCGCATCACTCTCGCAACATTA
back to top