g41.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg41.t1
Unique Nameg41.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:347598..348603 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g41g41Venturia canescensgenescaffold_1 347598..348603 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g41.t1g41.t1-PAVenturia canescenspolypeptidescaffold_1 347598..348603 -


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g41.t1-stop_codong41.t1-stop_codonVenturia canescensstop_codonscaffold_1 347598..347600 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g41.t1-CDSg41.t1-CDS-4Venturia canescensCDSscaffold_1 347598..347793 -
g41.t1-CDSg41.t1-CDS-3Venturia canescensCDSscaffold_1 347865..348068 -
g41.t1-CDSg41.t1-CDS-2Venturia canescensCDSscaffold_1 348160..348325 -
g41.t1-CDSg41.t1-CDS-1Venturia canescensCDSscaffold_1 348408..348603 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g41.t1-exong41.t1-exon-4Venturia canescensexonscaffold_1 347598..347793 -
g41.t1-exong41.t1-exon-3Venturia canescensexonscaffold_1 347865..348068 -
g41.t1-exong41.t1-exon-2Venturia canescensexonscaffold_1 348160..348325 -
g41.t1-exong41.t1-exon-1Venturia canescensexonscaffold_1 348408..348603 -


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g41.t1-introng41.t1-intronVenturia canescensintronscaffold_1 348326..348407 -


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g41.t1-start_codong41.t1-start_codonVenturia canescensstart_codonscaffold_1 348601..348603 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g41.t1 ID=g41.t1|Name=g41.t1|organism=Venturia canescens|type=mRNA|length=762bp|location=Sequence derived from alignment at scaffold_1:347598..348603- (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGGATTCAAAAGCACAAGCTTTGGTCAAACTGGATGCAGCGGTACATAA
TCTACACAAAAGTATCGCAGATTTTCCTGTCGGTGCAGTTTCCATATATG
ATTACAAACCTATTAAGGAGAAAATCCAAGATATTAGAGAATCATTGGTC
GCGCTGAGTGCCAAGGTTTTGACACTGAGAGCAAAAGTTGCAGCACAAAG
ACCAAGAGATCTGCCGGGTGAACTTAGCAATGATGATTTACACAAAGAAT
TTCAGGATAAAGTAGCGCAATCAGTAATCAACAGATTAGCCATTACATCT
TGTTTACAATCCGGTGAAATTCAAGACATTTTGGAAAACTCAGAAAAAAA
TGAAGTTACCATACAATTGAGAATTATAATGGAGAAGTTGTTCATTTTGA
ATGACGAAGTGATGACCTGGGAAAAAACAAGAGAACAGAAATTCACTGAA
GAACTTGATTTGAAGAGTGAGCTGCAGAATGCGTTGTCCGTATTTAGAGA
CTTTCTTACCAATCAAGGAAATATTAGAAAGGAAAAGCTCAAAGTAACTA
ATCCTAAAATAGCAGAGCAAAAAGAAGCGATAGATCGAAGGCTGCAAAAA
ATCAACGTAATGAAAAGACTGATAACAAATATGTGTGCCGCAGCCCCAAA
AGCGGTCAAGGATCAAGTGCTGAGGGACCTGTCGAAAAAGCACAGAGAGT
TATTGACCATCGAGGCCATCCAGGAAATGGCGAGAAATTATGAATACTCC
AAAAATGGGTAG
back to top

protein sequence of g41.t1

>g41.t1-PA ID=g41.t1-PA|Name=g41.t1|organism=Venturia canescens|type=polypeptide|length=253bp
MDSKAQALVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLV
ALSAKVLTLRAKVAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITS
CLQSGEIQDILENSEKNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTE
ELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQK
INVMKRLITNMCAAAPKAVKDQVLRDLSKKHRELLTIEAIQEMARNYEYS
KNG
back to top

mRNA from alignment at scaffold_1:347598..348603-

Legend: polypeptideCDSexonstart_codonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g41.t1 ID=g41.t1|Name=g41.t1|organism=Venturia canescens|type=mRNA|length=1006bp|location=Sequence derived from alignment at scaffold_1:347598..348603- (Venturia canescens)
ATGGATTCAAAAGCACAAGCTTTGGTCAAACTGGATGCAGCGGTACATAA TCTACACAAAAGTATCGCAGATTTTCCTGTCGGTGCAGTTTCCATATATG ATTACAAACCTATTAAGGAGAAAATCCAAGATATTAGAGAATCATTGGTC GCGCTGAGTGCCAAGGTTTTGACACTGAGAGCAAAAGTTGCAGCACGTAA GACTGTTTAAAAAAAAATTCAACAGTGACCAAAATTTATTGAATTATATT AAACAATGGATTTATATCCCTTTTTCAGAAAGACCAAGAGATCTGCCGGG TGAACTTAGCAATGATGATTTACACAAAGAATTTCAGGATAAAGTAGCGC AATCAGTAATCAACAGATTAGCCATTACATCTTGTTTACAATCCGGTGAA ATTCAAGACATTTTGGAAAACTCAGAAAAAAATGAAGTTACCATGTATAC AAATTTTTTAATGATCATTCTCCTTGAAAATGAATTGTTATCCACAGACT TTGATGACGACCTTAATCTTTTCCTAATATTTCAGACAATTGAGAATTAT AATGGAGAAGTTGTTCATTTTGAATGACGAAGTGATGACCTGGGAAAAAA CAAGAGAACAGAAATTCACTGAAGAACTTGATTTGAAGAGTGAGCTGCAG AATGCGTTGTCCGTATTTAGAGACTTTCTTACCAATCAAGGAAATATTAG AAAGGAAAAGCTCAAAGTAACTAATCCTAAAATAGCAGAGTAAGTCTCAG AAACTGAATCTCTTCCAAACTCCTATGATGTTCGGTTTTCAAAGTCATTC TTTCTTCAAGGCAAAAAGAAGCGATAGATCGAAGGCTGCAAAAAATCAAC GTAATGAAAAGACTGATAACAAATATGTGTGCCGCAGCCCCAAAAGCGGT CAAGGATCAAGTGCTGAGGGACCTGTCGAAAAAGCACAGAGAGTTATTGA CCATCGAGGCCATCCAGGAAATGGCGAGAAATTATGAATACTCCAAAAAT GGGTAG
back to top

Coding sequence (CDS) from alignment at scaffold_1:347598..348603-

>g41.t1 ID=g41.t1|Name=g41.t1|organism=Venturia canescens|type=CDS|length=762bp|location=Sequence derived from alignment at scaffold_1:347598..348603- (Venturia canescens)
ATGGATTCAAAAGCACAAGCTTTGGTCAAACTGGATGCAGCGGTACATAA
TCTACACAAAAGTATCGCAGATTTTCCTGTCGGTGCAGTTTCCATATATG
ATTACAAACCTATTAAGGAGAAAATCCAAGATATTAGAGAATCATTGGTC
GCGCTGAGTGCCAAGGTTTTGACACTGAGAGCAAAAGTTGCAGCACAAAG
ACCAAGAGATCTGCCGGGTGAACTTAGCAATGATGATTTACACAAAGAAT
TTCAGGATAAAGTAGCGCAATCAGTAATCAACAGATTAGCCATTACATCT
TGTTTACAATCCGGTGAAATTCAAGACATTTTGGAAAACTCAGAAAAAAA
TGAAGTTACCATACAATTGAGAATTATAATGGAGAAGTTGTTCATTTTGA
ATGACGAAGTGATGACCTGGGAAAAAACAAGAGAACAGAAATTCACTGAA
GAACTTGATTTGAAGAGTGAGCTGCAGAATGCGTTGTCCGTATTTAGAGA
CTTTCTTACCAATCAAGGAAATATTAGAAAGGAAAAGCTCAAAGTAACTA
ATCCTAAAATAGCAGAGCAAAAAGAAGCGATAGATCGAAGGCTGCAAAAA
ATCAACGTAATGAAAAGACTGATAACAAATATGTGTGCCGCAGCCCCAAA
AGCGGTCAAGGATCAAGTGCTGAGGGACCTGTCGAAAAAGCACAGAGAGT
TATTGACCATCGAGGCCATCCAGGAAATGGCGAGAAATTATGAATACTCC
AAAAATGGGTAG
back to top