g44.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg44.t1
Unique Nameg44.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:355242..356418 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g44g44Venturia canescensgenescaffold_1 355242..356418 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g44.t1g44.t1-PAVenturia canescenspolypeptidescaffold_1 355242..356418 -


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g44.t1-stop_codong44.t1-stop_codonVenturia canescensstop_codonscaffold_1 355242..355244 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g44.t1-CDSg44.t1-CDS-3Venturia canescensCDSscaffold_1 355242..355850 -
g44.t1-CDSg44.t1-CDS-2Venturia canescensCDSscaffold_1 355972..356177 -
g44.t1-CDSg44.t1-CDS-1Venturia canescensCDSscaffold_1 356277..356418 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g44.t1-exong44.t1-exon-3Venturia canescensexonscaffold_1 355242..355850 -
g44.t1-exong44.t1-exon-2Venturia canescensexonscaffold_1 355972..356177 -
g44.t1-exong44.t1-exon-1Venturia canescensexonscaffold_1 356277..356418 -


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g44.t1-introng44.t1-intronVenturia canescensintronscaffold_1 356178..356276 -


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g44.t1-start_codong44.t1-start_codonVenturia canescensstart_codonscaffold_1 356416..356418 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g44.t1 ID=g44.t1|Name=g44.t1|organism=Venturia canescens|type=mRNA|length=957bp|location=Sequence derived from alignment at scaffold_1:355242..356418- (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGTCTCGGGGAAAGAAGGCGAAAAAAAAAATTGGTGCTCGTAGGAAGCA
GGATTCTTCGGTGATCGCGTCGAGCATGCGGTTAACCGGAGCCGACGGAT
CTTCTGTAACGTCGATAAATAAATCTCACACGTTGGAGCTAAGTTCAAAG
TTAGCAAAAGCCAAACCCTTGAGATCGAAGAGTGTCGAAATTGCGGAGCG
AACGAGTAAGCTCGCAGAATCGAGAGATTTCAAGGAAAAAAAAGATGCTG
AGGTCGTTGGCAAATCGATAAACGCGAGCAATTTAGCAATATTTTTCAAA
AGTGAAGAACTCCAGACTCTCAGAAGTGTTCTTCGAAGAACTGACCTCTC
GAAAACTCCGCTCCTCCTCGGCGCCATAATCCTGGGCAAAGTGGACGTTG
TAAAAAGGCTTTTGCGGGACGGTTATCCGATCAATTCTCAAAGCGAAGAG
GATAAAACGACCGCGCTCATGTGGGCGGTTCGAAGGAAAGATCTCGAGAT
GATAAATTTATTGGTTCGTAACGGTGCCGACCTGACGCTGCTCGATGAAA
ACAACGACAACGTAGCTTTGATCGCAGTGCAATCTTCCTCCTGGGATCAA
AACGATTTCCTCGACTTTTGGTACAGCATCGATCGTAAAATAGACTTGAA
GCACGTCAACACGCGTGGCTACACGATACTGCATTACGCGAGGGAACGAC
AGTGGCATGTTCTCGCCAAACTGATCGACAGAAATTCCACTCTTTTGACG
AGGATCGATTCCATCTCGAAGAATCCTTGCTTCTGTTGCTATTGTTCGAC
TGCTTCAGCAACTCCGAGATACAAAAGCAAACAGGTTGGTCAATCGAGTA
TTGGGAAGAATGGACCCTCGAGCCAAATTTGGCACTGTGGTCGATCATTT
TTACCAGTTTTCCTTGTTTCTCAAGTTCTTCTGCAAGATTTTCGAGCCTG
CGAATAA
back to top

protein sequence of g44.t1

>g44.t1-PA ID=g44.t1-PA|Name=g44.t1|organism=Venturia canescens|type=polypeptide|length=318bp
MSRGKKAKKKIGARRKQDSSVIASSMRLTGADGSSVTSINKSHTLELSSK
LAKAKPLRSKSVEIAERTSKLAESRDFKEKKDAEVVGKSINASNLAIFFK
SEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEE
DKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQ
NDFLDFWYSIDRKIDLKHVNTRGYTILHYARERQWHVLAKLIDRNSTLLT
RIDSISKNPCFCCYCSTASATPRYKSKQVGQSSIGKNGPSSQIWHCGRSF
LPVFLVSQVLLQDFRACE
back to top

mRNA from alignment at scaffold_1:355242..356418-

Legend: polypeptideCDSexonstart_codonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g44.t1 ID=g44.t1|Name=g44.t1|organism=Venturia canescens|type=mRNA|length=1177bp|location=Sequence derived from alignment at scaffold_1:355242..356418- (Venturia canescens)
ATGTCTCGGGGAAAGAAGGCGAAAAAAAAAATTGGTGCTCGTAGGAAGCA GGATTCTTCGGTGATCGCGTCGAGCATGCGGTTAACCGGAGCCGACGGAT CTTCTGTAACGTCGATAAATAAATCTCACACGTTGGAGCTAAGTAAAAAG AAAAATAATGATGAATAACCAACGAATTAATGAGTGCGCCAAACTTATTT TCTTGCGTAACGTTCTCGTCATACGTTTTTCCTTCGAAAAGGTTCAAAGT TAGCAAAAGCCAAACCCTTGAGATCGAAGAGTGTCGAAATTGCGGAGCGA ACGAGTAAGCTCGCAGAATCGAGAGATTTCAAGGAAAAAAAAGATGCTGA GGTCGTTGGCAAATCGATAAACGCGAGCAATTTAGCAATATTTTTCAAAA GTGAAGAACTCCAGACTCTCAGAAGTGTTCTTCGAAGAACTGACCTCGTG AGAACGCATTGAATATCGTTTTAACGACGCGGTGGCTTTTTTTTCCGTGT ATAAAATCCATTGATTTGAAAAATCGAGTTAAAAACAGTCGAAAAGTGAA ATAAAAATATTTTTCCAGTCGAAAACTCCGCTCCTCCTCGGCGCCATAAT CCTGGGCAAAGTGGACGTTGTAAAAAGGCTTTTGCGGGACGGTTATCCGA TCAATTCTCAAAGCGAAGAGGATAAAACGACCGCGCTCATGTGGGCGGTT CGAAGGAAAGATCTCGAGATGATAAATTTATTGGTTCGTAACGGTGCCGA CCTGACGCTGCTCGATGAAAACAACGACAACGTAGCTTTGATCGCAGTGC AATCTTCCTCCTGGGATCAAAACGATTTCCTCGACTTTTGGTACAGCATC GATCGTAAAATAGACTTGAAGCACGTCAACACGCGTGGCTACACGATACT GCATTACGCGAGGGAACGACAGTGGCATGTTCTCGCCAAACTGATCGACA GAAATTCCACTCTTTTGACGAGGATCGATTCCATCTCGAAGAATCCTTGC TTCTGTTGCTATTGTTCGACTGCTTCAGCAACTCCGAGATACAAAAGCAA ACAGGTTGGTCAATCGAGTATTGGGAAGAATGGACCCTCGAGCCAAATTT GGCACTGTGGTCGATCATTTTTACCAGTTTTCCTTGTTTCTCAAGTTCTT CTGCAAGATTTTCGAGCCTGCGAATAA
back to top

Coding sequence (CDS) from alignment at scaffold_1:355242..356418-

>g44.t1 ID=g44.t1|Name=g44.t1|organism=Venturia canescens|type=CDS|length=957bp|location=Sequence derived from alignment at scaffold_1:355242..356418- (Venturia canescens)
ATGTCTCGGGGAAAGAAGGCGAAAAAAAAAATTGGTGCTCGTAGGAAGCA
GGATTCTTCGGTGATCGCGTCGAGCATGCGGTTAACCGGAGCCGACGGAT
CTTCTGTAACGTCGATAAATAAATCTCACACGTTGGAGCTAAGTTCAAAG
TTAGCAAAAGCCAAACCCTTGAGATCGAAGAGTGTCGAAATTGCGGAGCG
AACGAGTAAGCTCGCAGAATCGAGAGATTTCAAGGAAAAAAAAGATGCTG
AGGTCGTTGGCAAATCGATAAACGCGAGCAATTTAGCAATATTTTTCAAA
AGTGAAGAACTCCAGACTCTCAGAAGTGTTCTTCGAAGAACTGACCTCTC
GAAAACTCCGCTCCTCCTCGGCGCCATAATCCTGGGCAAAGTGGACGTTG
TAAAAAGGCTTTTGCGGGACGGTTATCCGATCAATTCTCAAAGCGAAGAG
GATAAAACGACCGCGCTCATGTGGGCGGTTCGAAGGAAAGATCTCGAGAT
GATAAATTTATTGGTTCGTAACGGTGCCGACCTGACGCTGCTCGATGAAA
ACAACGACAACGTAGCTTTGATCGCAGTGCAATCTTCCTCCTGGGATCAA
AACGATTTCCTCGACTTTTGGTACAGCATCGATCGTAAAATAGACTTGAA
GCACGTCAACACGCGTGGCTACACGATACTGCATTACGCGAGGGAACGAC
AGTGGCATGTTCTCGCCAAACTGATCGACAGAAATTCCACTCTTTTGACG
AGGATCGATTCCATCTCGAAGAATCCTTGCTTCTGTTGCTATTGTTCGAC
TGCTTCAGCAACTCCGAGATACAAAAGCAAACAGGTTGGTCAATCGAGTA
TTGGGAAGAATGGACCCTCGAGCCAAATTTGGCACTGTGGTCGATCATTT
TTACCAGTTTTCCTTGTTTCTCAAGTTCTTCTGCAAGATTTTCGAGCCTG
CGAATAA
back to top