g5385.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg5385.t1
Unique Nameg5385.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_39483contigscaffold_39483:2..194 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g5385g5385Venturia canescensgenescaffold_39483 2..194 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g5385.t1-CDSg5385.t1-CDS-1Venturia canescensCDSscaffold_39483 2..194 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g5385.t1-exong5385.t1-exon-1Venturia canescensexonscaffold_39483 2..194 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g5385.t1g5385.t1-PAVenturia canescenspolypeptidescaffold_39483 2..194 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g5385.t1 ID=g5385.t1|Name=g5385.t1|organism=Venturia canescens|type=mRNA|length=193bp|location=Sequence derived from alignment at scaffold_39483:2..194+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
CTGTGAAGAACGGCTGCGAGTTCGCTGTTAATATACCCGCCATCCCCACT
CAGGGCGCAGGTGGTGGTGGTAGCTGCGGTGGTGGTGGTGGCAGTAGTGG
TGGTGGTAGCTGCGGTGGTGGTGGTGGCAATGGTGGTGGTGGCTGGGCCC
TGAAATGCCCCCATGGCAACGTGTCCGTGCTGTCGGGTAGAAG
back to top

protein sequence of g5385.t1

>g5385.t1-PA ID=g5385.t1-PA|Name=g5385.t1|organism=Venturia canescens|type=polypeptide|length=63bp
VKNGCEFAVNIPAIPTQGAGGGGSCGGGGGSSGGGSCGGGGGNGGGGWAL
KCPHGNVSVLSGR
back to top

mRNA from alignment at scaffold_39483:2..194+

Legend: CDSpolypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g5385.t1 ID=g5385.t1|Name=g5385.t1|organism=Venturia canescens|type=mRNA|length=193bp|location=Sequence derived from alignment at scaffold_39483:2..194+ (Venturia canescens)
CTGTGAAGAACGGCTGCGAGTTCGCTGTTAATATACCCGCCATCCCCACT CAGGGCGCAGGTGGTGGTGGTAGCTGCGGTGGTGGTGGTGGCAGTAGTGG TGGTGGTAGCTGCGGTGGTGGTGGTGGCAATGGTGGTGGTGGCTGGGCCC TGAAATGCCCCCATGGCAACGTGTCCGTGCTGTCGGGTAGAAG
back to top

Coding sequence (CDS) from alignment at scaffold_39483:2..194+

>g5385.t1 ID=g5385.t1|Name=g5385.t1|organism=Venturia canescens|type=CDS|length=193bp|location=Sequence derived from alignment at scaffold_39483:2..194+ (Venturia canescens)
CTGTGAAGAACGGCTGCGAGTTCGCTGTTAATATACCCGCCATCCCCACT
CAGGGCGCAGGTGGTGGTGGTAGCTGCGGTGGTGGTGGTGGCAGTAGTGG
TGGTGGTAGCTGCGGTGGTGGTGGTGGCAATGGTGGTGGTGGCTGGGCCC
TGAAATGCCCCCATGGCAACGTGTCCGTGCTGTCGGGTAGAAG
back to top