g69.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg69.t1
Unique Nameg69.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:531963..533531 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g69g69Venturia canescensgenescaffold_1 531963..533531 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g69.t1g69.t1-PAVenturia canescenspolypeptidescaffold_1 531963..533531 -


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g69.t1-stop_codong69.t1-stop_codonVenturia canescensstop_codonscaffold_1 531963..531965 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g69.t1-CDSg69.t1-CDS-5Venturia canescensCDSscaffold_1 531963..532478 -
g69.t1-CDSg69.t1-CDS-4Venturia canescensCDSscaffold_1 532555..532674 -
g69.t1-CDSg69.t1-CDS-3Venturia canescensCDSscaffold_1 532795..533073 -
g69.t1-CDSg69.t1-CDS-2Venturia canescensCDSscaffold_1 533153..533260 -
g69.t1-CDSg69.t1-CDS-1Venturia canescensCDSscaffold_1 533334..533531 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g69.t1-exong69.t1-exon-5Venturia canescensexonscaffold_1 531963..532478 -
g69.t1-exong69.t1-exon-4Venturia canescensexonscaffold_1 532555..532674 -
g69.t1-exong69.t1-exon-3Venturia canescensexonscaffold_1 532795..533073 -
g69.t1-exong69.t1-exon-2Venturia canescensexonscaffold_1 533153..533260 -
g69.t1-exong69.t1-exon-1Venturia canescensexonscaffold_1 533334..533531 -


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g69.t1-introng69.t1-intronVenturia canescensintronscaffold_1 533261..533333 -


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g69.t1-start_codong69.t1-start_codonVenturia canescensstart_codonscaffold_1 533529..533531 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g69.t1 ID=g69.t1|Name=g69.t1|organism=Venturia canescens|type=mRNA|length=1221bp|location=Sequence derived from alignment at scaffold_1:531963..533531- (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGCCAGAAGAAGCAAAAGAATATACTTTGTTCAAACATTTAACTGCCAA
AATAAAGGCCTGTGGGCCGATAACTGTAGCAGATTATATGAAAGAAGTGC
TCACTCATCCAACTGCAGGGTATTACATGAACAGAGACGTTTTTGGTCAA
CATGGTGATTTTATAACTTCTCCTGAAATCAGTCAACTTTTTGGAGAGAT
GATTGGCATTTGGATCGTAAATGAGCTTTCAAAAATTACCGAAGATTCTT
TTCAGCTCGTTGAACTGGGCCCAGGCCGAGGAACTCTTTGCAAAGATATC
TTACGTGTTTTAAAACGACTCAAATTGATACACAGAGCATCTATACACTT
AGTGGAGATAAGTCCAGCTCTGTCAAAAATACAATCAGAAAAATTATGCG
TGTCCAGCAAGGAATGTCCCCAGGCAGTGTCAAAAAAGGATAATTCTGTG
AGTCATTACAGGGAAGGATTGACAGAAGAAGGAATCAAAGTCTTCTGGTA
CAGTTCCATCAAAGACATACCAAAAAAGTTCAGCGTCTTTGTGGCTCACG
AATTTTTTGACGCTTTGCCAATACACAAATTTCAGAAAACTGGCGACATT
TGGAACGAGGTTTTGATTGATATTGATCCAAAGACAGAAAACGAGAAAAA
ATTTCGTTATGTATTGACTAAAAGGGCAACTCCAGCAAGCGCAATATTCG
TTTCAAGAGACGAAAAAAGAGATCACGTTGAGGTGAGTCCTCAAACAATA
GTAATAATAGATTACATGGCCTCGTTTCTCGAGGAATTTGGAGGATTCGC
GTTGATCGCGGATTACGGTCACAATGGCGAAAAAACAGATACTTTCCGAT
CGTTCCGGCGACACGAACAATACGATCCGCTGATGGAACCGGGAACCGCT
GATCTGACGGCTGACGTGGATTTTTCGTTGATCGATAGAGTCGGTCGAAA
GGAAAGCCGTCTCATATCGTTCGGCCCGATGGATCAATGCAGCTTTTTGA
AAAACTTGGGAATAGACGTACGATTGGAGATGTTATTAAAAAATGCATCT
GACGAAGAGAGAAGCCACATAGAATCGGGATATCATATGATAATGGACGA
GGATAAAATGGGCACGCGTTTCAAAGTCTTCTCGTTTTTCCCCAGTGTCC
TCGAAGCTTATTTGGCCCAGTGGCCGGTCGCCGGTTTTTCGAATCCTCAA
CAAGAGGCTTTGAAGAAATAA
back to top

protein sequence of g69.t1

>g69.t1-PA ID=g69.t1-PA|Name=g69.t1|organism=Venturia canescens|type=polypeptide|length=406bp
MPEEAKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQ
HGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDI
LRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSKKDNSV
SHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDI
WNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTI
VIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTA
DLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNAS
DEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGFSNPQ
QEALKK
back to top

mRNA from alignment at scaffold_1:531963..533531-

Legend: polypeptideCDSexonstart_codonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g69.t1 ID=g69.t1|Name=g69.t1|organism=Venturia canescens|type=mRNA|length=1569bp|location=Sequence derived from alignment at scaffold_1:531963..533531- (Venturia canescens)
ATGCCAGAAGAAGCAAAAGAATATACTTTGTTCAAACATTTAACTGCCAA AATAAAGGCCTGTGGGCCGATAACTGTAGCAGATTATATGAAAGAAGTGC TCACTCATCCAACTGCAGGGTATTACATGAACAGAGACGTTTTTGGTCAA CATGGTGATTTTATAACTTCTCCTGAAATCAGTCAACTTTTTGGAGAGGT AAGTTAATTTTTAGGCAATTGATTTTTCAAACTAAAACAGAGATTGCAGT ATTTGAATTACTTTTTTTCAGATGATTGGCATTTGGATCGTAAATGAGCT TTCAAAAATTACCGAAGATTCTTTTCAGCTCGTTGAACTGGGCCCAGGCC GAGGAACTCTTTGCAAAGATATCTTACGTGTAAATTTGTACATCAATTTC TCATGAATTACTTCAAATGCTCAGAAGTGATTTTTATGAGTTCCTACTTT TCGAACAGGTTTTAAAACGACTCAAATTGATACACAGAGCATCTATACAC TTAGTGGAGATAAGTCCAGCTCTGTCAAAAATACAATCAGAAAAATTATG CGTGTCCAGCAAGGAATGTCCCCAGGCAGTGTCAAAAAAGGATAATTCTG TGAGTCATTACAGGGAAGGATTGACAGAAGAAGGAATCAAAGTCTTCTGG TACAGTTCCATCAAAGACATACCAAAAAAGTTCAGCGTCTTTGTGGCTCA CGAATTTTTTGACGCTTTGCCAATACACAAATTTCAGGTACAAGCAAACA ATTATTCCATAAAAATATTTTTTCATAAAACAATAGCAACGAAACCCTTG TAACGTATTCCAGCTCTGTTTGCTTCTAACGCTCGACTGAAATTTTGTCA ATTTTAGAAAACTGGCGACATTTGGAACGAGGTTTTGATTGATATTGATC CAAAGACAGAAAACGAGAAAAAATTTCGTTATGTATTGACTAAAAGGGCA ACTCCAGCAAGCGCAATATTCGTTTCAGTAAGAGTGCACCTGAATTCGTG GTCATGATGACTTTCGTCATTAGAACGTCCTAAAGATTTGTTATTATTTG CAGAGAGACGAAAAAAGAGATCACGTTGAGGTGAGTCCTCAAACAATAGT AATAATAGATTACATGGCCTCGTTTCTCGAGGAATTTGGAGGATTCGCGT TGATCGCGGATTACGGTCACAATGGCGAAAAAACAGATACTTTCCGATCG TTCCGGCGACACGAACAATACGATCCGCTGATGGAACCGGGAACCGCTGA TCTGACGGCTGACGTGGATTTTTCGTTGATCGATAGAGTCGGTCGAAAGG AAAGCCGTCTCATATCGTTCGGCCCGATGGATCAATGCAGCTTTTTGAAA AACTTGGGAATAGACGTACGATTGGAGATGTTATTAAAAAATGCATCTGA CGAAGAGAGAAGCCACATAGAATCGGGATATCATATGATAATGGACGAGG ATAAAATGGGCACGCGTTTCAAAGTCTTCTCGTTTTTCCCCAGTGTCCTC GAAGCTTATTTGGCCCAGTGGCCGGTCGCCGGTTTTTCGAATCCTCAACA AGAGGCTTTGAAGAAATAA
back to top

Coding sequence (CDS) from alignment at scaffold_1:531963..533531-

>g69.t1 ID=g69.t1|Name=g69.t1|organism=Venturia canescens|type=CDS|length=1221bp|location=Sequence derived from alignment at scaffold_1:531963..533531- (Venturia canescens)
ATGCCAGAAGAAGCAAAAGAATATACTTTGTTCAAACATTTAACTGCCAA
AATAAAGGCCTGTGGGCCGATAACTGTAGCAGATTATATGAAAGAAGTGC
TCACTCATCCAACTGCAGGGTATTACATGAACAGAGACGTTTTTGGTCAA
CATGGTGATTTTATAACTTCTCCTGAAATCAGTCAACTTTTTGGAGAGAT
GATTGGCATTTGGATCGTAAATGAGCTTTCAAAAATTACCGAAGATTCTT
TTCAGCTCGTTGAACTGGGCCCAGGCCGAGGAACTCTTTGCAAAGATATC
TTACGTGTTTTAAAACGACTCAAATTGATACACAGAGCATCTATACACTT
AGTGGAGATAAGTCCAGCTCTGTCAAAAATACAATCAGAAAAATTATGCG
TGTCCAGCAAGGAATGTCCCCAGGCAGTGTCAAAAAAGGATAATTCTGTG
AGTCATTACAGGGAAGGATTGACAGAAGAAGGAATCAAAGTCTTCTGGTA
CAGTTCCATCAAAGACATACCAAAAAAGTTCAGCGTCTTTGTGGCTCACG
AATTTTTTGACGCTTTGCCAATACACAAATTTCAGAAAACTGGCGACATT
TGGAACGAGGTTTTGATTGATATTGATCCAAAGACAGAAAACGAGAAAAA
ATTTCGTTATGTATTGACTAAAAGGGCAACTCCAGCAAGCGCAATATTCG
TTTCAAGAGACGAAAAAAGAGATCACGTTGAGGTGAGTCCTCAAACAATA
GTAATAATAGATTACATGGCCTCGTTTCTCGAGGAATTTGGAGGATTCGC
GTTGATCGCGGATTACGGTCACAATGGCGAAAAAACAGATACTTTCCGAT
CGTTCCGGCGACACGAACAATACGATCCGCTGATGGAACCGGGAACCGCT
GATCTGACGGCTGACGTGGATTTTTCGTTGATCGATAGAGTCGGTCGAAA
GGAAAGCCGTCTCATATCGTTCGGCCCGATGGATCAATGCAGCTTTTTGA
AAAACTTGGGAATAGACGTACGATTGGAGATGTTATTAAAAAATGCATCT
GACGAAGAGAGAAGCCACATAGAATCGGGATATCATATGATAATGGACGA
GGATAAAATGGGCACGCGTTTCAAAGTCTTCTCGTTTTTCCCCAGTGTCC
TCGAAGCTTATTTGGCCCAGTGGCCGGTCGCCGGTTTTTCGAATCCTCAA
CAAGAGGCTTTGAAGAAATAA
back to top