g70.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg70.t1
Unique Nameg70.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:534295..536999 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g70g70Venturia canescensgenescaffold_1 534295..536999 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g70.t1-start_codong70.t1-start_codonVenturia canescensstart_codonscaffold_1 534295..534297 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g70.t1-CDSg70.t1-CDS-1Venturia canescensCDSscaffold_1 534295..534357 +
g70.t1-CDSg70.t1-CDS-2Venturia canescensCDSscaffold_1 534764..534844 +
g70.t1-CDSg70.t1-CDS-3Venturia canescensCDSscaffold_1 535077..535280 +
g70.t1-CDSg70.t1-CDS-4Venturia canescensCDSscaffold_1 535362..535579 +
g70.t1-CDSg70.t1-CDS-5Venturia canescensCDSscaffold_1 535892..536298 +
g70.t1-CDSg70.t1-CDS-6Venturia canescensCDSscaffold_1 536542..536999 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g70.t1-exong70.t1-exon-1Venturia canescensexonscaffold_1 534295..534357 +
g70.t1-exong70.t1-exon-2Venturia canescensexonscaffold_1 534764..534844 +
g70.t1-exong70.t1-exon-3Venturia canescensexonscaffold_1 535077..535280 +
g70.t1-exong70.t1-exon-4Venturia canescensexonscaffold_1 535362..535579 +
g70.t1-exong70.t1-exon-5Venturia canescensexonscaffold_1 535892..536298 +
g70.t1-exong70.t1-exon-6Venturia canescensexonscaffold_1 536542..536999 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g70.t1-introng70.t1-intronVenturia canescensintronscaffold_1 536299..536541 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g70.t1-stop_codong70.t1-stop_codonVenturia canescensstop_codonscaffold_1 536997..536999 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g70.t1g70.t1-PAVenturia canescenspolypeptidescaffold_1 534295..536999 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g70.t1 ID=g70.t1|Name=g70.t1|organism=Venturia canescens|type=mRNA|length=1431bp|location=Sequence derived from alignment at scaffold_1:534295..536999+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGGGATCTTCCCACAGCGTGGAAATACCGGGTGGTGGTACCGAGGGTTA
TCACGTACTTCGAGTTCAAGAAAACTCGCCTGGACAGAAAGCAGGACTTG
AAGCCTTCTTCGACTTTATTGTTTCCATCAACAATACTCGTTTGGATCAA
GACAATGATACGCTGAAGGAAATTCTAAAAGCTGGCGTTGGTAAAGAACT
CACTATGACAGTTTACAACAGCAAGACTCAGTCTGTGAGACAAACAGTCA
TTGAGCCTAGTATGACGTGGGGCGGCCATGGGTTGCTCGGGGTGAGCATT
CGTTTCTGTTCCTTCGAAGGAGCGAATGAAAATGTTTGGCATGTTCTTGA
AGTGCATCCATCCTCACCTGCAGAATTAGCTGGTCTGAGACCATTCACAG
ATTACATTATAGGATCAGATTCAGCCCTCCACGAGAGCGAAGATCTTTAC
TCTCTCATAGAAGCCCACGAATCACGTGCTCTTAAACTCTATGTGTACAA
CACCGAGGAAGACACGTGTCGCGAAGTTACCATCACTCCCAACAGTACCT
GGGGTGGTGAAGGAAGCTTAGGATGTGGGATCGGATACGGATATCTCCAC
AGAATACCGTTAAGAAGTATATCAGAAACGTCGACGAAAACTGCTTTTCC
ACATTTAGTGAACCCTGTCGCTGCTCAGGTTTCGCCAAGCGCGTACACGA
GTCCGATTATTGTGAACCCACCGACCAGCGTACCACCAGGTTTCACAATA
CCTCAGAATTACACTCCAACGACAGCACCGAGCGATACCGATAAGCCGAG
AGAAGGCACTGGTAGTAGCACGAGTGTTGCTATGACGCCTGTTATTCCAA
CAGTGCCGACGATACCGACCAGCAGTGTTTATCCCGTTTTAGACCCGGCC
GTGGCTGGAGCCTCGACTACGACCAATCCTACCGGACATTTGTTCTCGCA
GCCTGCCAGTAATTATCCTCACGTTGGAGGAGTTACGAGCGGATACCAGG
ACACACCAAGCATTCCTGGAATGCCAACTGTTCCTCCACTGCCACCATTA
CCAGCGGAAATGAGCGTGCCTATGGGATCTGTAGTAACTCATAATCCCCA
GCAGAATTACGATCCTTCCATACCGAGCGTAATCCCCGGTATGACGTCGT
ACATGCCGTCGGAGCCTTCGATCGTAACGACACCGATAGAGCTACCGGGC
ATGCCACCGATAACCGTGAGTGCGAGCCTTCCACAAACCGCTGCCTTCTA
CTCTCCAATGTTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAA
CAACAACAGCAGCAGCAGCAGCATCAATCGCCTCCGAGCACCGTAACGAA
TCCCTTATCGGCTCAAACTTCGGCTCAATAA
back to top

protein sequence of g70.t1

>g70.t1-PA ID=g70.t1-PA|Name=g70.t1|organism=Venturia canescens|type=polypeptide|length=476bp
MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQ
DNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSI
RFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLY
SLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLH
RIPLRSISETSTKTAFPHLVNPVAAQVSPSAYTSPIIVNPPTSVPPGFTI
PQNYTPTTAPSDTDKPREGTGSSTSVAMTPVIPTVPTIPTSSVYPVLDPA
VAGASTTTNPTGHLFSQPASNYPHVGGVTSGYQDTPSIPGMPTVPPLPPL
PAEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPSEPSIVTTPIELPG
MPPITVSASLPQTAAFYSPMLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQHQSPPSTVTNPLSAQTSAQ
back to top

mRNA from alignment at scaffold_1:534295..536999+

Legend: start_codonpolypeptideCDSexonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g70.t1 ID=g70.t1|Name=g70.t1|organism=Venturia canescens|type=mRNA|length=2705bp|location=Sequence derived from alignment at scaffold_1:534295..536999+ (Venturia canescens)
ATGGGATCTTCCCACAGCGTGGAAATACCGGGTGGTGGTACCGAGGGTTA TCACGTACTTCGAGTGAGTTAATAACAGAGCTTATTCAAAAGCATTTAAT TTTTCATTCATCAGTATTTTTATGATTCAGTTGTTTCCTTGATAAAAGGA TTGTTAACTTACGCAACTTCGTCGTATTACAATTCATCAATCCAATTCAT TATTGAACTGCGAATCTTTCATTTCGTAATATTCTATCTGCCTTTCCTTA CGAAACGAAAAATGACAGACCTCACGTAAACTAATAATCGTAGCGGGCAT AAACTAAATCCTATGCTCACGAACTTCAATAAACATATCGCCACTTTAAT TTATATGTCTCAATAATTATGGATAGAATTCATCACTAGATAATAAAATA ATTATTTCCACAAATTTAGAACTGCAACATTTCATTATTTATACTCTAAG AGTTATTATTATTTTTTAGGTTCAAGAAAACTCGCCTGGACAGAAAGCAG GACTTGAAGCCTTCTTCGACTTTATTGTTTCCATCAACAATACTCGTTTG GTAATATTCATTTTTTTTTTGTATAATTGTTCTAGCAATAAACAATAAAA TCAAGAGTTTTTCATGAAAATCTTATTTTCTGGAACATAACTCTAAGATG GATGGAATCCTGATGAGAATACTGAAAAGAGATAAAATGTTGAAAAATTA AAAAATGATTTACAATTTCAAATCGCAAAAAAACTGTAAAATCATTGGAA AATTACTGACTGTGAAAATTGCCTAATTATAGGATCAAGACAATGATACG CTGAAGGAAATTCTAAAAGCTGGCGTTGGTAAAGAACTCACTATGACAGT TTACAACAGCAAGACTCAGTCTGTGAGACAAACAGTCATTGAGCCTAGTA TGACGTGGGGCGGCCATGGGTTGCTCGGGGTGAGCATTCGTTTCTGTTCC TTCGAAGGAGCGAATGAAAATGTTTGGCATGTTCTTGTGAGTATAAAATT GGCTACCTCATCCTTACCTTATTCCCCTGTCTTCATTTTTCTCTCTATAT GTATGTTCGTTACCCAGGAAGTGCATCCATCCTCACCTGCAGAATTAGCT GGTCTGAGACCATTCACAGATTACATTATAGGATCAGATTCAGCCCTCCA CGAGAGCGAAGATCTTTACTCTCTCATAGAAGCCCACGAATCACGTGCTC TTAAACTCTATGTGTACAACACCGAGGAAGACACGTGTCGCGAAGTTACC ATCACTCCCAACAGTACCTGGGGTGGTGAAGGAAGGTGCGTGCTTGGTTT TTTTTTTCATTTATACATAAATAATGAAGTAAAATAATGCATCGAGTCGC AAAAGTGCTAAACTCCAGTTTACTTTTAGGGCGTCTTTTTTTTCTAATCG ACAAGAATTATACTGTGCAAAATCTCCTTTTCTCATCTCAAGAACATCAG AGTTACAGTATTTTCGCCAAAAAGTCAAAATGATAAATTGAGATTCAAAC TCTAAAATTTAAGATTTTCTGTCTCAGACTGCAGTTCCTCAATTCAGTCT CAATTTTATGTCGAGTTAGTTTTATAATTTTGTTGTCGATTTTGCAGCTT AGGATGTGGGATCGGATACGGATATCTCCACAGAATACCGTTAAGAAGTA TATCAGAAACGTCGACGAAAACTGCTTTTCCACATTTAGTGAACCCTGTC GCTGCTCAGGTTTCGCCAAGCGCGTACACGAGTCCGATTATTGTGAACCC ACCGACCAGCGTACCACCAGGTTTCACAATACCTCAGAATTACACTCCAA CGACAGCACCGAGCGATACCGATAAGCCGAGAGAAGGCACTGGTAGTAGC ACGAGTGTTGCTATGACGCCTGTTATTCCAACAGTGCCGACGATACCGAC CAGCAGTGTTTATCCCGTTTTAGACCCGGCCGTGGCTGGAGCCTCGACTA CGACCAATCCTACCGGACATTTGTTCTCGCAGCCTGCCAGTAATTATCCT CACGGTGAGTATTTCATGAATGTGGATAATAGAAGAAACCGAAAATTATT TACTTCAATAAACAAGTTTCAAAATAATCTTCGAACATTGGCATCGTCAG CAGTTTCATCAATTTTTTCCAATGCCATAAATCGTCGTGTCTTATCGGTA GTCAAATGTAATAATCGAGCTTTTTAATTCTAAGATAACGACCGTAGAAA AAATGATTGAAAAATACTGCTTCATTGAATATTACTGTACAATTTAGTTG GAGGAGTTACGAGCGGATACCAGGACACACCAAGCATTCCTGGAATGCCA ACTGTTCCTCCACTGCCACCATTACCAGCGGAAATGAGCGTGCCTATGGG ATCTGTAGTAACTCATAATCCCCAGCAGAATTACGATCCTTCCATACCGA GCGTAATCCCCGGTATGACGTCGTACATGCCGTCGGAGCCTTCGATCGTA ACGACACCGATAGAGCTACCGGGCATGCCACCGATAACCGTGAGTGCGAG CCTTCCACAAACCGCTGCCTTCTACTCTCCAATGTTGCAGCAGCAGCAGC AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG CAGCAACAACAACAACAACAACAACAACAACAGCAGCAGCAGCAGCATCA ATCGCCTCCGAGCACCGTAACGAATCCCTTATCGGCTCAAACTTCGGCTC AATAA
back to top

Coding sequence (CDS) from alignment at scaffold_1:534295..536999+

>g70.t1 ID=g70.t1|Name=g70.t1|organism=Venturia canescens|type=CDS|length=1431bp|location=Sequence derived from alignment at scaffold_1:534295..536999+ (Venturia canescens)
ATGGGATCTTCCCACAGCGTGGAAATACCGGGTGGTGGTACCGAGGGTTA
TCACGTACTTCGAGTTCAAGAAAACTCGCCTGGACAGAAAGCAGGACTTG
AAGCCTTCTTCGACTTTATTGTTTCCATCAACAATACTCGTTTGGATCAA
GACAATGATACGCTGAAGGAAATTCTAAAAGCTGGCGTTGGTAAAGAACT
CACTATGACAGTTTACAACAGCAAGACTCAGTCTGTGAGACAAACAGTCA
TTGAGCCTAGTATGACGTGGGGCGGCCATGGGTTGCTCGGGGTGAGCATT
CGTTTCTGTTCCTTCGAAGGAGCGAATGAAAATGTTTGGCATGTTCTTGA
AGTGCATCCATCCTCACCTGCAGAATTAGCTGGTCTGAGACCATTCACAG
ATTACATTATAGGATCAGATTCAGCCCTCCACGAGAGCGAAGATCTTTAC
TCTCTCATAGAAGCCCACGAATCACGTGCTCTTAAACTCTATGTGTACAA
CACCGAGGAAGACACGTGTCGCGAAGTTACCATCACTCCCAACAGTACCT
GGGGTGGTGAAGGAAGCTTAGGATGTGGGATCGGATACGGATATCTCCAC
AGAATACCGTTAAGAAGTATATCAGAAACGTCGACGAAAACTGCTTTTCC
ACATTTAGTGAACCCTGTCGCTGCTCAGGTTTCGCCAAGCGCGTACACGA
GTCCGATTATTGTGAACCCACCGACCAGCGTACCACCAGGTTTCACAATA
CCTCAGAATTACACTCCAACGACAGCACCGAGCGATACCGATAAGCCGAG
AGAAGGCACTGGTAGTAGCACGAGTGTTGCTATGACGCCTGTTATTCCAA
CAGTGCCGACGATACCGACCAGCAGTGTTTATCCCGTTTTAGACCCGGCC
GTGGCTGGAGCCTCGACTACGACCAATCCTACCGGACATTTGTTCTCGCA
GCCTGCCAGTAATTATCCTCACGTTGGAGGAGTTACGAGCGGATACCAGG
ACACACCAAGCATTCCTGGAATGCCAACTGTTCCTCCACTGCCACCATTA
CCAGCGGAAATGAGCGTGCCTATGGGATCTGTAGTAACTCATAATCCCCA
GCAGAATTACGATCCTTCCATACCGAGCGTAATCCCCGGTATGACGTCGT
ACATGCCGTCGGAGCCTTCGATCGTAACGACACCGATAGAGCTACCGGGC
ATGCCACCGATAACCGTGAGTGCGAGCCTTCCACAAACCGCTGCCTTCTA
CTCTCCAATGTTGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAA
CAACAACAGCAGCAGCAGCAGCATCAATCGCCTCCGAGCACCGTAACGAA
TCCCTTATCGGCTCAAACTTCGGCTCAATAA
back to top