g72.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg72.t1
Unique Nameg72.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:539132..547864 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g72g72Venturia canescensgenescaffold_1 539132..547864 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g72.t1-start_codong72.t1-start_codonVenturia canescensstart_codonscaffold_1 539132..539134 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g72.t1-CDSg72.t1-CDS-1Venturia canescensCDSscaffold_1 539132..539146 +
g72.t1-CDSg72.t1-CDS-2Venturia canescensCDSscaffold_1 539240..539342 +
g72.t1-CDSg72.t1-CDS-3Venturia canescensCDSscaffold_1 539474..539669 +
g72.t1-CDSg72.t1-CDS-4Venturia canescensCDSscaffold_1 540029..540371 +
g72.t1-CDSg72.t1-CDS-5Venturia canescensCDSscaffold_1 540474..547637 +
g72.t1-CDSg72.t1-CDS-6Venturia canescensCDSscaffold_1 547736..547864 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g72.t1-exong72.t1-exon-1Venturia canescensexonscaffold_1 539132..539146 +
g72.t1-exong72.t1-exon-2Venturia canescensexonscaffold_1 539240..539342 +
g72.t1-exong72.t1-exon-3Venturia canescensexonscaffold_1 539474..539669 +
g72.t1-exong72.t1-exon-4Venturia canescensexonscaffold_1 540029..540371 +
g72.t1-exong72.t1-exon-5Venturia canescensexonscaffold_1 540474..547637 +
g72.t1-exong72.t1-exon-6Venturia canescensexonscaffold_1 547736..547864 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g72.t1-introng72.t1-intronVenturia canescensintronscaffold_1 547638..547735 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g72.t1-stop_codong72.t1-stop_codonVenturia canescensstop_codonscaffold_1 547862..547864 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g72.t1g72.t1-PAVenturia canescenspolypeptidescaffold_1 539132..547864 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g72.t1 ID=g72.t1|Name=g72.t1|organism=Venturia canescens|type=mRNA|length=7950bp|location=Sequence derived from alignment at scaffold_1:539132..547864+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGGCGGATGCCGAGTTAACGAGAGCGTTGAAGGATCTTCCAAATCGTAT
TCAAACAGCTGGTAAAAAGGAGCGGCGCGAAATATTCGAGAATGTCATTA
ACGTGTTGTCAAATCCTGCCATCAATGACAAGATACTCGGAGGCATATGC
AAGATTGCTTCAATCACGCTGCATCGATATAAGGATACAGCTTCCCAATC
TTACGTGAAAGGGCTGATAGTTGCTATGATCAAACAACATCCAGAAACGG
TTATCAAACATCTAGCTGCTGTTATTACGGAGCAAGCTGTATGGCACAAA
AATGTAGTACCGACTAAAAATACAGCTCTGAGCGCATACTTGGCATTAAA
ATGGTCTACGCTTCTTGTACAACACGGAGCGAGCAAAGACTCGCAATCGT
TGAAAGATGAACTACCAAAGGTGATAGAGGCGCAAGCAAATTTGAGCGCA
GCGGCTGTTGCCTCTATGGACAAAAAGTTGAACGACAAAGTTTATTCTCT
ACTGAGTCATCAGTGGAAAGTATCTGCAAATTCCGATGAAAGGTATCTCG
ATGTGTTGAGCAATCTCGAAGCCAGCAACGGAGTCATAGTTCTTGCCAGT
TTATTCACAAAATACCTGATTTCAAACGACAAAGAAAAGCTGGCAGACAC
ATTCAAGGTAAAGATTTTGGATTCCTTCATAAAGGTAGCTATAAGTTGCA
AAAAAAAGCCACAATTGTACGTGGTCGAAGCTGCAGAGCCATTTCTCCGA
CGGCTGACACACGATGATTTCAAAGATCAGTTATTGCCTGCTCTGCAAAA
ATCGATGTTACGAAATCCGGAAATCATAATAGATTCGGTGGGTCACATAC
TGAGCGGTTTGAGCCTCGACCTGAGTCGTTACAGTGAGGAAATAAGTAAA
GGATTGTTCGCGAATCTCCATTCGAAAGAGGATTCGGTGCGGGAGGCAGC
AGCCGAAGCGTGTCGAAGATTGGCTCTCCAATGTTCGGACACAGCGGCTT
TGGAGAAGCTGCTCGCGTCGTTATTCGCAGTTTTTCACGGTTCGGAGGGC
AAGCTAACGATGGTAACGCACAAGATTTCGGTGTTACAAGGGGCAGGGAA
CTTGAGTCAAAATGCGGCATCGGGGAGCGGCGTTCAGACCGTAGCGGAAG
TGGCTTGCGGGCATTTTATAAAAGTTCTCGAGACAGAGGTGCACGAGAAG
ACGCTTATACACGCCCTCGAAATGATGACACTGTGGTGCGCGAAATTCGT
CAATCAAGTACCAAAGAGCGTGATCGAAACGTTCAAGAAAGGCATGGCAG
CTAAGAGCTCGACAGCGGGTGTGAGGACGGCGTACATAAAGCTCATAATG
TCCGTCAACGTGATATCACATTCGGCGACGTTGTCACCGATCCTGAGTCA
AGCGATAACCCGTGCGATGCAGCAGGCGGCCCAACCGCCGGTGGTAACGG
AGGGTCTCGTCGCTGCGCATTTGCTTCTGAAGCTGGTGATCGCTGGTGAA
GTTGAAAACGACAAGCAGAACGTGCTCTGGAACGCGATCGACGAGCAAAT
CTTTTTCGGTGAAAAATTTTTGTCAACTTGCTCCGACGATATTCTTTACA
ATCTGATGCAATTCTGCGAGAAATTGATAGTCGAATACGCCGATCGGTTG
AACGAGAAAGCCCTGAGCGGCGTTCACAGAGCGATCGTCGCCTGCGTCAC
CGCCCCGAAATCATCGACCCGTCGACGCTGCGCTCCTCTCGCTAAAAAGC
TTCTCACGGGTCTCGGCACTTACGAACCTGCGCAAGCCCTTCTCCTCGAG
TTCAACAAGTTCCTCGAGAACGCCAGGATTTACGAGGGCGATCGGGAGAA
CAAGGACGAGGGTCCGCCGAGCGGCGAAGTCACGGGGCGATCGCTGGCCG
ATGGTTTGCTCGCCGTTTGCTCCGGTTCGTTCCTCTTCGAGCAGCCCGCT
CTCCGACTCGTAACAGATTCGCTGATCCCCGCTCATCATCCAGCGATTCT
CAAGGCCGTTCCGAATCTGTGGTCCAAAATCGTGAAAAACTTTGATCTCG
CACCCCGCGATTTTCTCGTACGTTGTCTCGGTGATGTGAAAACAATGTTT
ATCGATAATTATCGAGCAACGCCTTCGTACGAGAACGCACTCGGTACGAT
AGTCTCTCTGACTCCGGATCTCGTGCTCGGAGCCCTCGTCGCTAACGTAA
CCAGCAAATTGGACGACCCGGAAATTCTGCGGGTCACCAAGGACGAGTAT
TTCACGTATCTGACGCCGGACGGCGAGCTGTACGACAAAAGCGTTATTCC
GGGGAACGACGAGAACGACATTTTGAACTCGATGAACATGAAACGCGAGA
GCAAAGTTTATTCGTTCAAGGAACAACAAGAGGAATTACAGCTGAGACGA
GAGTTGTACGAGAAGAGAAAGCGCGAGGGTAAAATAAAAGAGCCGAAATT
GACAGCGAAACAGGAAGAAGCTTTGAAGAGTCAGATCGCTCGTGAGAACG
CGATAAGAAAAAGGCTGCGTGAGTTTCAATCGAAAATAACGCTCGCCGTG
TCGATGATGAAAGCTGCGATTCTCGGCGACAAATTTCACTCGTCATTTTA
CCTGAAAGATTTGTTGGCACCGATCCTGAAAAATCTCGTGTCCCCGCTGG
CTGCTCCGACGATGTCACAGCTGTACATCGAGTTGGGCAAAATCGTCGAG
ATAACGAAAGATCGAACGATGAGTTCTCTCGTGGCGCATGTAACGCTCAG
ACAATTGGAGCCCCAGTGCGATCTGGAGGCCGCATGGCAAGAGGAAGACC
TCGAGAAAGCGGTTTCGAGGACTTTGAATCTGCTGCACAATTACACGGTG
CGCCAAAAACAATTGTTGATAGCTCCGGCTTTCTGCTACATTTTTCCATT
CGTGATGAAAACCTTGTTGACCTGGAAAGACGAATCGATTATCAGCGAGG
GCCTCCAGATCGTCCAGGAGCACGCTAAGCAGCGCGGGGCTCCGAACGAC
TTCGAAGATCCTCGACACCCGAGATTGCTGCCGAGGAAGCAAATGTTCGA
TTTGTTGATCGAGCTCATGAGCTCGACCGCAGGGAGAATACAATCGCACG
CGGTGGCAACTTTCCTCGACGTCGCTCGATCGGGCAGCGGAACCGCGGAC
TGCGCGACTGCTTCCGGCGACGAGATCGACTCCTTGATGGGTGCGCTGCA
GAACAATTTACCAGCGGTTCGTGACGCGGCCCTCCGCGCCCTCATGATCG
TCAAACTCGCATTCCCCTCGGAGAAGGAAGACTACGAGCAACTTTTACGC
CTCACTCGACGAGTCTGGATCGCCAAGTTCGACACGAGCGACGAGAACAA
AGTTTTAGCTGACGAGCTCTGGGAAGCTTCCGGTTTCGCAGCGAGTCCGG
AAATTCTTTGCGAAGAGTTGATTCAGGACGTCGCCCATCCGGTCGAGTCT
GTGCAACAAGCCGCGGCTCTGGCGATGGCTCAACTGCTCAAAAGCGCTCC
CGAACTCATGCCCGGTATCCTCGACAGTCTTTTGGAACTTTACCAGGAAA
AATTGGCAATGATACCTCCGAAATTGAACGATTTTGGCAGAGTCGTCGAG
CAGCCGATCGACACGTGGGGCCCGAGGCGCGGAGTCGCTCTGGCGCTGGC
TCAACTGGCGCCGTTGCTCACACCCGAAACGATAAATCGTCTCGTGGAAT
TTTTCGTCTCGACCGGACTGGGCGATCGCAACACGTCCGTCCGAACGGAA
ATGCTCGTCGCGGCCGTCGCCGCGGTCGATTATCACGGCAAGGCAAACAT
CACCTCGCTGCTGCCAGTTTTCGAGAACTTCATGGACAAAGCTCCGAAGA
TCGGAAGCTTCGATTCCATCAAGCAATCGGTCGTCATCCTCATGGGCTCT
CTCGCGAGGCACTTGGAGAAAGACGACCCCAGGATAAAGCCCATCGTGAT
GAGACTGATCGCCGCTTTATCGACGCCCTCGCAGCAGGTCCAGGAAGCGG
TGGCCAACTGTCTGCCGCATCTCGTGCCTTCGATAAAGGAAGACGCGCCC
AGGATCGTCGACAATCTCATGGACCAGCTTCTCAAGTCCGACAAATACGG
GGAGCGGAAAGGAGCCGCTTACGGTCTTGCGGGTCTCATAAAAGGCATGG
GGATTCTCGCTTTGAAACAACTCGACATCATGACCACCCTGACCAACGCG
ATTCAGGACAAAAAGAATTACCGACACCGTGAAGGCGCCCTCTTCGCTTT
CGAGATGCTCTGCACGATGCTCGGCAGACTTTTCGAGCCTTACATAGTAC
ACGTGCTGCCGCATCTGTTGCTCTGCTTCGGGGACTCGAGTCAGTACGTG
CGGGCCGCGACCGACGACACCGCGCGCGTCGTCATGAGCAAGCTGTCGGC
TCACGGAGTGAAGCTCGTTTTGCCGAGTTTACTCGCCGCCCTCGAAGAAG
ATTCCTGGAGAACGAAGACCGGCTCCGTCGAACTGCTCGGCGCGATGGCT
TACTGCGCACCGAAACAATTGAGCAGCTGCCTGCCGAGCATCGTGCCCAA
GCTGATCGAAGTACTGAGCGATTCGCACACCAAAGTCCAAGAGGCTGGAG
CCGAAGCGCTCAAAGTAATCGGGAGCGTAATCAGGAATCCTGAGATCCAA
GCGATCGTCCCGGTCCTCCTTAAAGCGCTTCAAGATCCGTCGAGAAAAAC
CGCCACGTGTCTCCAGACCCTTCTGGACACGCAGTTCGTTCATTTCATCG
ACGCCCCGTCGCTCGCCCTGATAATGCCGGTCGTCCAGCGCGCCTTCATG
GACCGTTCGACCGAGACGAGAAAAATGGCCGCGCAGATTATCGGAAACAT
GTATTCCTTGACTGACCAAAAAGACTTGACGCCTTATTTGCCGACTATTA
TTCCAGGCTTGAAAACCAGCCTGTTGGACCCGGTGCCGGAGGTTCGAAGC
GTTTCAGCCCGCGCTCTCGGCGCCATGGTACGAGGAATGGGAGAATCGAG
CTTCGAGGATCTCCTGCCCTGGCTCATGCAGACTCTGACCTCGGAAACTA
GCAGCGTCGACAGGTCCGGTGCGGCCCAGGGATTGTCCGAAGTCGTGCGG
GGTCTCGGAGTCGAGAAGCTGCACAAACTCATGCCGGAGATAATAAGCAC
TGCGGAACGTACGGACATCGCTCCGCACGTGAAAGACGGTTATATAATGA
TGTTCATTTACATGCCAAGTGCCTTTACGAGGGAGTTCACGCCTTACATA
GGACAGATTATAAATCCGATTCTCAAAGCTTTGGCCGACGAGAACGAGTA
CGTTAGAGAAACGGCGTTACGGGCTGGCCAGAGGATAGTTACTTTGTACG
CTGACACGGCGATAATGCTTCTGTTGCCGGAGCTCGAGAAAGGGCTCTTC
GATGACAACTGGCGGATACGATACTCGTCGGTGCAATTGTTGGGTGATTT
GCTCTACCACATTTCCGGTGTTTCAGGAAAAATGTCGACGGAGACTGCGA
GCGAAGACGATAATTTCGGCACGGAGCAGTCCCACTACGCGATTATAAAC
GCTCTCGGTGCGGAAAGGAGGCACCGCGTTCTCGCCGGTCTCTACATGGG
TCGATCGGACGTCGCTCTGATGGTGCGACAAGCGGCGCTCCACGTTTGGA
AGGTCGTCGTGACCAACACGCCCAGGACGCTAAGAGAGATACTCCCGACG
TTGTTCAGCCTTCTGCTCGGTTGTCTCGCGAGCACGAGCTACGACAAGCG
CCAAGTTGCGGCCCGGACCCTCGGGGATCTCGTGAGAAAACTCGGCGAGA
GAGTGTTGCCAGAAATCATACCGATTTTGGAGCGGGGACTGCAGAGCAAC
CAGGCCGATCAGAGGCAGGGCGTGTGCATCGGGCTCTCGGAGATAATGGC
GAGCACCAGCAAAGACATGGTTCTTACGTTCGTCAACAGCCTCGTACCAA
CCGTGAGGAAAGCTCTTTGCGATCCTCTCCCGGAGGTGAGACAAGCCGCT
GCGAAAACGTTCGACAGCTTGCACTCGACCGTCGGAGTCCGTGCCCTCGA
CGACATTTTACCGGCTATGCTGACGCAACTAAACTCACCGGATCAGTCCG
AAGCCGAGAACACGCTCGACGGGCTGCGCCAAGTCATGGCCATCAAGTCT
CGCGTCGTCCTGCCCTATCTCGTTCCACAGCTGACCAGCCAACCGGTAAA
CACGAAAGCACTGTCGATCTTGGCGAGCGTCGCCGGCGAAGCGCTTACAA
GATTCCTGCACAAGATTCTGCCCGCTCTTCTGACCGCGCTCTCGAGCGCC
CAGGGAACACCGAACGAGGCCCAGGAACTCGAGTACTGCCAGGCCGTCAT
ACTCTCCATCACGGATGAGGTCGGCGTTCGAACGGTCATGGACCAACTGA
TGGACGCGACGAAAGCCGACGACGTGTCTCGGAGGCGCAGCGCGGCCACG
TTGCTCTGCGCCTTCTGCAGGGACACCCGGGCCGACTACAGCCAATACGT
GCCGCAGCTGCTCCGCGGCCTCCTGCATCTTTTCACCGACGAGGACAAAG
AGGTTTTGCAAAAGAGCTGGGAAGCTCTGACCGCCGTGACGAAAACGCTC
GGTTCCGATCAACAAATCGCTCACGTTCAAGATATTCGACAAGCCGTCCG
CTTCGCCGTCTCCGATCTCAAGGGACAGGAATTGCTGCCCGGCTTCTGTC
TGCCCAAAGGCATCACTCCCATTTTACCGATCTTCCGCGAAGCGATCCTC
AACGGCATGCCCGAAGCGAAGGAACAGGCTGCCCAGGGCCTCGGCGAGGT
GATCAAATTGACGAGCGCCAACGCCCTCCAGCCCAGCGTCGTCCACATCA
CCGGACCCCTCATCCGCATCCTCGGCGACCGCTTCAACTGGAGCGTGAAA
GCCGCCGTTCTCGAAACACTCGCGATTCTCCTCGGCAAAGTCGGCGTTAT
GCTCAAACAATTTTTGCCACAGTTACAGACGACCTTCCTCAAGGCTCTCA
ACGACAGCAACCGCCAAGTGAGGCTCAAGGCCGCTTACGCTCTGAGCAAC
CTCATCGTCATACACACCCGCGCCGATCCTCTCTTCGCCGAGCTCCACAC
CGGCATCAAAACTTCCGACGATTCGGCCATCAGAGAAACCATGCTCCAAG
CCCTCCGAGGAGTCCTGACACCCGCCGGCGACAAGATGACCGAGCCCATG
AGGAAACAGGTCTTCGTCACGTTGAGCTCGATGCTCGGACATCCCGACGA
CGTCACGAGAACCGCCGTAGCCGGTTGTTACGGCGCTCTCCTCCGGTGGC
TCAGCCCCGAACAGCTCGCCAACGCTTTCAACGAAAATCTCCTTTGCAAC
GACGCCAACGCCGATTGGATGCTCAGACACGGTCGCTCCGCTGCCCTCTT
CGTCGTTCTCAAAGAATCCCCAGCCACCATTTACGCCGCTAACGAGGAAG
AACGCGCCTGCAAAGTAATCCTCTCGTACCTCGCCGCCGACCGCGTACAA
ATCGCCATGAACGGCGTTCGCGCCTGCGGATATCTTTTCCAATATCTCAT
GATGGAAAATCTTCCTATCCCAATCGTTATCCTCACTCCCTTCGTACGAT
CCATGAACAACAACAGCAACGACGTCAAACAACTCTTGGCCAGGGTGTGC
ACTCACATCGCCCGGAATATTCCTCCGAGTAAAATGTCACCGGAACTTCT
CAAGGCCCTTATTCCCATGCTGGTCAACGGCACCAAGGAGAAAAATGGAT
ACGTCAAAGCCAACAGCGAATTGGCTCTCATTGCTGTTCTTCGGCTTAAG
CAGGGTGACGAGGAACAGCAGCGTTGCATGGCCCTTCTGGACGTCGGAGC
ACGAGAATCCTTGTCCGACGTCGTGAGCAAAGTATTGCGAAAGGTGTTGT
CCCAGCCCGAGGGCAAGATAGAAGAGCTGGACGACACGTTACTCACGTGA
back to top

protein sequence of g72.t1

>g72.t1-PA ID=g72.t1-PA|Name=g72.t1|organism=Venturia canescens|type=polypeptide|length=2649bp
MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGIC
KIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHK
NVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSA
AAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLAS
LFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLR
RLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISK
GLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEG
KLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEK
TLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIM
SVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGE
VENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRL
NEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLE
FNKFLENARIYEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPA
LRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMF
IDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEY
FTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRR
ELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAV
SMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVE
ITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTV
RQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPND
FEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTAD
CATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLR
LTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVES
VQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVE
QPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTE
MLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGS
LARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAP
RIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNA
IQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYV
RAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMA
YCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQ
AIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFM
DRSTETRKMAAQIIGNMYSLTDQKDLTPYLPTIIPGLKTSLLDPVPEVRS
VSARALGAMVRGMGESSFEDLLPWLMQTLTSETSSVDRSGAAQGLSEVVR
GLGVEKLHKLMPEIISTAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYI
GQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLF
DDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIIN
ALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPT
LFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSN
QADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAA
AKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKS
RVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSA
QGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAAT
LLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTL
GSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAIL
NGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVK
AAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSN
LIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPM
RKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCN
DANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQ
IAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVC
THIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLK
QGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
back to top

mRNA from alignment at scaffold_1:539132..547864+

Legend: start_codonpolypeptideCDSexonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g72.t1 ID=g72.t1|Name=g72.t1|organism=Venturia canescens|type=mRNA|length=8733bp|location=Sequence derived from alignment at scaffold_1:539132..547864+ (Venturia canescens)
ATGGCGGATGCCGAGGTGAGTTTGTCACGTGGAATAAAGCCGAAAAGTGT TAGCCGATTCGGTTTAAACTGTTGTAACAAATACTTGATGAATTCATTTT TCTTATAGTTAACGAGAGCGTTGAAGGATCTTCCAAATCGTATTCAAACA GCTGGTAAAAAGGAGCGGCGCGAAATATTCGAGAATGTCATTAACGTGTT GTCAAATCCTGGTGAGTGGAATTCCAATGAAAAACAACAAATATATTTTT AACCATTTTTCTCCAAATAATGTTGTCATTGTGTTTAATAATATTCGTCC ACCTTCCATTTTCGAATGTATAATATTGTCTCAAATTTGTAGCCATCAAT GACAAGATACTCGGAGGCATATGCAAGATTGCTTCAATCACGCTGCATCG ATATAAGGATACAGCTTCCCAATCTTACGTGAAAGGGCTGATAGTTGCTA TGATCAAACAACATCCAGAAACGGTTATCAAACATCTAGCTGCTGTTATT ACGGAGCAAGCTGTATGGCACAAAAATGTAGTACCGACGTAAGCTTTTAT TTTTCCTAATCAGATTGCTTCAGAATTTAATTTTATCATACCTCTGTGAG TATCACAGTTGCCCAATAGAGAATAATTCCAGCTTGGCATACTCCAGGAT TAGTTTGACCGATTCCTGAAACATTATCGTTTTTCCTATAATTTTAATAA TTTTTTATAAATTAAATCAAAAACTAAAAGCTTGAATTGTGAGTTTTCTC TATTCGTTTGAAATGTGAACAGTAATGACTTTTTTTGAATCCTTGTTAAA TCAGAAGTTTCTACAATTTCAAAATTTTTAACACGATAGACCTTACACTG ACAGAAATAGTTGATACAATTTTTCATTGAGACACAATTCTCTACAGTAA AAATACAGCTCTGAGCGCATACTTGGCATTAAAATGGTCTACGCTTCTTG TACAACACGGAGCGAGCAAAGACTCGCAATCGTTGAAAGATGAACTACCA AAGGTGATAGAGGCGCAAGCAAATTTGAGCGCAGCGGCTGTTGCCTCTAT GGACAAAAAGTTGAACGACAAAGTTTATTCTCTACTGAGTCATCAGTGGA AAGTATCTGCAAATTCCGATGAAAGGTATCTCGATGTGTTGAGCAATCTC GAAGCCAGCAACGGAGTCATAGTTCTTGCCAGTTTATTCACAAAATACCT GATTTCAAACGACAAAGAAAAGCTGGCAGACACATTCAAGGTAAAACAAC GATTCAGGGATAATTTTGAGTTTCAAATGCAGTAAAAAAATATAATTTTT CACCTACTGAAGTTTCGAGAGACTCATGGAAGTTTTTTGCAGGTAAAGAT TTTGGATTCCTTCATAAAGGTAGCTATAAGTTGCAAAAAAAAGCCACAAT TGTACGTGGTCGAAGCTGCAGAGCCATTTCTCCGACGGCTGACACACGAT GATTTCAAAGATCAGTTATTGCCTGCTCTGCAAAAATCGATGTTACGAAA TCCGGAAATCATAATAGATTCGGTGGGTCACATACTGAGCGGTTTGAGCC TCGACCTGAGTCGTTACAGTGAGGAAATAAGTAAAGGATTGTTCGCGAAT CTCCATTCGAAAGAGGATTCGGTGCGGGAGGCAGCAGCCGAAGCGTGTCG AAGATTGGCTCTCCAATGTTCGGACACAGCGGCTTTGGAGAAGCTGCTCG CGTCGTTATTCGCAGTTTTTCACGGTTCGGAGGGCAAGCTAACGATGGTA ACGCACAAGATTTCGGTGTTACAAGGGGCAGGGAACTTGAGTCAAAATGC GGCATCGGGGAGCGGCGTTCAGACCGTAGCGGAAGTGGCTTGCGGGCATT TTATAAAAGTTCTCGAGACAGAGGTGCACGAGAAGACGCTTATACACGCC CTCGAAATGATGACACTGTGGTGCGCGAAATTCGTCAATCAAGTACCAAA GAGCGTGATCGAAACGTTCAAGAAAGGCATGGCAGCTAAGAGCTCGACAG CGGGTGTGAGGACGGCGTACATAAAGCTCATAATGTCCGTCAACGTGATA TCACATTCGGCGACGTTGTCACCGATCCTGAGTCAAGCGATAACCCGTGC GATGCAGCAGGCGGCCCAACCGCCGGTGGTAACGGAGGGTCTCGTCGCTG CGCATTTGCTTCTGAAGCTGGTGATCGCTGGTGAAGTTGAAAACGACAAG CAGAACGTGCTCTGGAACGCGATCGACGAGCAAATCTTTTTCGGTGAAAA ATTTTTGTCAACTTGCTCCGACGATATTCTTTACAATCTGATGCAATTCT GCGAGAAATTGATAGTCGAATACGCCGATCGGTTGAACGAGAAAGCCCTG AGCGGCGTTCACAGAGCGATCGTCGCCTGCGTCACCGCCCCGAAATCATC GACCCGTCGACGCTGCGCTCCTCTCGCTAAAAAGCTTCTCACGGGTCTCG GCACTTACGAACCTGCGCAAGCCCTTCTCCTCGAGTTCAACAAGTTCCTC GAGAACGCCAGGATTTACGAGGGCGATCGGGAGAACAAGGACGAGGGTCC GCCGAGCGGCGAAGTCACGGGGCGATCGCTGGCCGATGGTTTGCTCGCCG TTTGCTCCGGTTCGTTCCTCTTCGAGCAGCCCGCTCTCCGACTCGTAACA GATTCGCTGATCCCCGCTCATCATCCAGCGATTCTCAAGGCCGTTCCGAA TCTGTGGTCCAAAATCGTGAAAAACTTTGATCTCGCACCCCGCGATTTTC TCGTACGTTGTCTCGGTGATGTGAAAACAATGTTTATCGATAATTATCGA GCAACGCCTTCGTACGAGAACGCACTCGGTACGATAGTCTCTCTGACTCC GGATCTCGTGCTCGGAGCCCTCGTCGCTAACGTAACCAGCAAATTGGACG ACCCGGAAATTCTGCGGGTCACCAAGGACGAGTATTTCACGTATCTGACG CCGGACGGCGAGCTGTACGACAAAAGCGTTATTCCGGGGAACGACGAGAA CGACATTTTGAACTCGATGAACATGAAACGCGAGAGCAAAGTTTATTCGT TCAAGGAACAACAAGAGGAATTACAGCTGAGACGAGAGTTGTACGAGAAG AGAAAGCGCGAGGGTAAAATAAAAGAGCCGAAATTGACAGCGAAACAGGA AGAAGCTTTGAAGAGTCAGATCGCTCGTGAGAACGCGATAAGAAAAAGGC TGCGTGAGTTTCAATCGAAAATAACGCTCGCCGTGTCGATGATGAAAGCT GCGATTCTCGGCGACAAATTTCACTCGTCATTTTACCTGAAAGATTTGTT GGCACCGATCCTGAAAAATCTCGTGTCCCCGCTGGCTGCTCCGACGATGT CACAGCTGTACATCGAGTTGGGCAAAATCGTCGAGATAACGAAAGATCGA ACGATGAGTTCTCTCGTGGCGCATGTAACGCTCAGACAATTGGAGCCCCA GTGCGATCTGGAGGCCGCATGGCAAGAGGAAGACCTCGAGAAAGCGGTTT CGAGGACTTTGAATCTGCTGCACAATTACACGGTGCGCCAAAAACAATTG TTGATAGCTCCGGCTTTCTGCTACATTTTTCCATTCGTGATGAAAACCTT GTTGACCTGGAAAGACGAATCGATTATCAGCGAGGGCCTCCAGATCGTCC AGGAGCACGCTAAGCAGCGCGGGGCTCCGAACGACTTCGAAGATCCTCGA CACCCGAGATTGCTGCCGAGGAAGCAAATGTTCGATTTGTTGATCGAGCT CATGAGCTCGACCGCAGGGAGAATACAATCGCACGCGGTGGCAACTTTCC TCGACGTCGCTCGATCGGGCAGCGGAACCGCGGACTGCGCGACTGCTTCC GGCGACGAGATCGACTCCTTGATGGGTGCGCTGCAGAACAATTTACCAGC GGTTCGTGACGCGGCCCTCCGCGCCCTCATGATCGTCAAACTCGCATTCC CCTCGGAGAAGGAAGACTACGAGCAACTTTTACGCCTCACTCGACGAGTC TGGATCGCCAAGTTCGACACGAGCGACGAGAACAAAGTTTTAGCTGACGA GCTCTGGGAAGCTTCCGGTTTCGCAGCGAGTCCGGAAATTCTTTGCGAAG AGTTGATTCAGGACGTCGCCCATCCGGTCGAGTCTGTGCAACAAGCCGCG GCTCTGGCGATGGCTCAACTGCTCAAAAGCGCTCCCGAACTCATGCCCGG TATCCTCGACAGTCTTTTGGAACTTTACCAGGAAAAATTGGCAATGATAC CTCCGAAATTGAACGATTTTGGCAGAGTCGTCGAGCAGCCGATCGACACG TGGGGCCCGAGGCGCGGAGTCGCTCTGGCGCTGGCTCAACTGGCGCCGTT GCTCACACCCGAAACGATAAATCGTCTCGTGGAATTTTTCGTCTCGACCG GACTGGGCGATCGCAACACGTCCGTCCGAACGGAAATGCTCGTCGCGGCC GTCGCCGCGGTCGATTATCACGGCAAGGCAAACATCACCTCGCTGCTGCC AGTTTTCGAGAACTTCATGGACAAAGCTCCGAAGATCGGAAGCTTCGATT CCATCAAGCAATCGGTCGTCATCCTCATGGGCTCTCTCGCGAGGCACTTG GAGAAAGACGACCCCAGGATAAAGCCCATCGTGATGAGACTGATCGCCGC TTTATCGACGCCCTCGCAGCAGGTCCAGGAAGCGGTGGCCAACTGTCTGC CGCATCTCGTGCCTTCGATAAAGGAAGACGCGCCCAGGATCGTCGACAAT CTCATGGACCAGCTTCTCAAGTCCGACAAATACGGGGAGCGGAAAGGAGC CGCTTACGGTCTTGCGGGTCTCATAAAAGGCATGGGGATTCTCGCTTTGA AACAACTCGACATCATGACCACCCTGACCAACGCGATTCAGGACAAAAAG AATTACCGACACCGTGAAGGCGCCCTCTTCGCTTTCGAGATGCTCTGCAC GATGCTCGGCAGACTTTTCGAGCCTTACATAGTACACGTGCTGCCGCATC TGTTGCTCTGCTTCGGGGACTCGAGTCAGTACGTGCGGGCCGCGACCGAC GACACCGCGCGCGTCGTCATGAGCAAGCTGTCGGCTCACGGAGTGAAGCT CGTTTTGCCGAGTTTACTCGCCGCCCTCGAAGAAGATTCCTGGAGAACGA AGACCGGCTCCGTCGAACTGCTCGGCGCGATGGCTTACTGCGCACCGAAA CAATTGAGCAGCTGCCTGCCGAGCATCGTGCCCAAGCTGATCGAAGTACT GAGCGATTCGCACACCAAAGTCCAAGAGGCTGGAGCCGAAGCGCTCAAAG TAATCGGGAGCGTAATCAGGAATCCTGAGATCCAAGCGATCGTCCCGGTC CTCCTTAAAGCGCTTCAAGATCCGTCGAGAAAAACCGCCACGTGTCTCCA GACCCTTCTGGACACGCAGTTCGTTCATTTCATCGACGCCCCGTCGCTCG CCCTGATAATGCCGGTCGTCCAGCGCGCCTTCATGGACCGTTCGACCGAG ACGAGAAAAATGGCCGCGCAGATTATCGGAAACATGTATTCCTTGACTGA CCAAAAAGACTTGACGCCTTATTTGCCGACTATTATTCCAGGCTTGAAAA CCAGCCTGTTGGACCCGGTGCCGGAGGTTCGAAGCGTTTCAGCCCGCGCT CTCGGCGCCATGGTACGAGGAATGGGAGAATCGAGCTTCGAGGATCTCCT GCCCTGGCTCATGCAGACTCTGACCTCGGAAACTAGCAGCGTCGACAGGT CCGGTGCGGCCCAGGGATTGTCCGAAGTCGTGCGGGGTCTCGGAGTCGAG AAGCTGCACAAACTCATGCCGGAGATAATAAGCACTGCGGAACGTACGGA CATCGCTCCGCACGTGAAAGACGGTTATATAATGATGTTCATTTACATGC CAAGTGCCTTTACGAGGGAGTTCACGCCTTACATAGGACAGATTATAAAT CCGATTCTCAAAGCTTTGGCCGACGAGAACGAGTACGTTAGAGAAACGGC GTTACGGGCTGGCCAGAGGATAGTTACTTTGTACGCTGACACGGCGATAA TGCTTCTGTTGCCGGAGCTCGAGAAAGGGCTCTTCGATGACAACTGGCGG ATACGATACTCGTCGGTGCAATTGTTGGGTGATTTGCTCTACCACATTTC CGGTGTTTCAGGAAAAATGTCGACGGAGACTGCGAGCGAAGACGATAATT TCGGCACGGAGCAGTCCCACTACGCGATTATAAACGCTCTCGGTGCGGAA AGGAGGCACCGCGTTCTCGCCGGTCTCTACATGGGTCGATCGGACGTCGC TCTGATGGTGCGACAAGCGGCGCTCCACGTTTGGAAGGTCGTCGTGACCA ACACGCCCAGGACGCTAAGAGAGATACTCCCGACGTTGTTCAGCCTTCTG CTCGGTTGTCTCGCGAGCACGAGCTACGACAAGCGCCAAGTTGCGGCCCG GACCCTCGGGGATCTCGTGAGAAAACTCGGCGAGAGAGTGTTGCCAGAAA TCATACCGATTTTGGAGCGGGGACTGCAGAGCAACCAGGCCGATCAGAGG CAGGGCGTGTGCATCGGGCTCTCGGAGATAATGGCGAGCACCAGCAAAGA CATGGTTCTTACGTTCGTCAACAGCCTCGTACCAACCGTGAGGAAAGCTC TTTGCGATCCTCTCCCGGAGGTGAGACAAGCCGCTGCGAAAACGTTCGAC AGCTTGCACTCGACCGTCGGAGTCCGTGCCCTCGACGACATTTTACCGGC TATGCTGACGCAACTAAACTCACCGGATCAGTCCGAAGCCGAGAACACGC TCGACGGGCTGCGCCAAGTCATGGCCATCAAGTCTCGCGTCGTCCTGCCC TATCTCGTTCCACAGCTGACCAGCCAACCGGTAAACACGAAAGCACTGTC GATCTTGGCGAGCGTCGCCGGCGAAGCGCTTACAAGATTCCTGCACAAGA TTCTGCCCGCTCTTCTGACCGCGCTCTCGAGCGCCCAGGGAACACCGAAC GAGGCCCAGGAACTCGAGTACTGCCAGGCCGTCATACTCTCCATCACGGA TGAGGTCGGCGTTCGAACGGTCATGGACCAACTGATGGACGCGACGAAAG CCGACGACGTGTCTCGGAGGCGCAGCGCGGCCACGTTGCTCTGCGCCTTC TGCAGGGACACCCGGGCCGACTACAGCCAATACGTGCCGCAGCTGCTCCG CGGCCTCCTGCATCTTTTCACCGACGAGGACAAAGAGGTTTTGCAAAAGA GCTGGGAAGCTCTGACCGCCGTGACGAAAACGCTCGGTTCCGATCAACAA ATCGCTCACGTTCAAGATATTCGACAAGCCGTCCGCTTCGCCGTCTCCGA TCTCAAGGGACAGGAATTGCTGCCCGGCTTCTGTCTGCCCAAAGGCATCA CTCCCATTTTACCGATCTTCCGCGAAGCGATCCTCAACGGCATGCCCGAA GCGAAGGAACAGGCTGCCCAGGGCCTCGGCGAGGTGATCAAATTGACGAG CGCCAACGCCCTCCAGCCCAGCGTCGTCCACATCACCGGACCCCTCATCC GCATCCTCGGCGACCGCTTCAACTGGAGCGTGAAAGCCGCCGTTCTCGAA ACACTCGCGATTCTCCTCGGCAAAGTCGGCGTTATGCTCAAACAATTTTT GCCACAGTTACAGACGACCTTCCTCAAGGCTCTCAACGACAGCAACCGCC AAGTGAGGCTCAAGGCCGCTTACGCTCTGAGCAACCTCATCGTCATACAC ACCCGCGCCGATCCTCTCTTCGCCGAGCTCCACACCGGCATCAAAACTTC CGACGATTCGGCCATCAGAGAAACCATGCTCCAAGCCCTCCGAGGAGTCC TGACACCCGCCGGCGACAAGATGACCGAGCCCATGAGGAAACAGGTCTTC GTCACGTTGAGCTCGATGCTCGGACATCCCGACGACGTCACGAGAACCGC CGTAGCCGGTTGTTACGGCGCTCTCCTCCGGTGGCTCAGCCCCGAACAGC TCGCCAACGCTTTCAACGAAAATCTCCTTTGCAACGACGCCAACGCCGAT TGGATGCTCAGACACGGTCGCTCCGCTGCCCTCTTCGTCGTTCTCAAAGA ATCCCCAGCCACCATTTACGCCGCTAACGAGGAAGAACGCGCCTGCAAAG TAATCCTCTCGTACCTCGCCGCCGACCGCGTACAAATCGCCATGAACGGC GTTCGCGCCTGCGGATATCTTTTCCAATATCTCATGATGGAAAATCTTCC TATCCCAATCGTTATCCTCACTCCCTTCGTACGATCCATGAACAACAACA GCAACGACGTCAAACAACTCTTGGCCAGGGTGTGCACTCACATCGCCCGG AATATTCCTCCGAGTAAAATGTCACCGGAACTTCTCAAGGCCCTTATTCC CATGCTGGTCAACGGCACCAAGGAGAAAAATGGATACGTCAAAGCCAACA GCGAATTGGCTCTCATTGCTGTTCTTCGGCTTAAGCAGGGTGACGAGGAA CAGCAGGTAACTTCGTTCGGCACTTTGGAAAAGAATTTTTTTTCGAATCT TCAAATTATTCATTCCAGTTTGAAACTCGTGAAAAAATATTATTCATTTT GCAGCGTTGCATGGCCCTTCTGGACGTCGGAGCACGAGAATCCTTGTCCG ACGTCGTGAGCAAAGTATTGCGAAAGGTGTTGTCCCAGCCCGAGGGCAAG ATAGAAGAGCTGGACGACACGTTACTCACGTGA
back to top

Coding sequence (CDS) from alignment at scaffold_1:539132..547864+

>g72.t1 ID=g72.t1|Name=g72.t1|organism=Venturia canescens|type=CDS|length=7950bp|location=Sequence derived from alignment at scaffold_1:539132..547864+ (Venturia canescens)
ATGGCGGATGCCGAGTTAACGAGAGCGTTGAAGGATCTTCCAAATCGTAT
TCAAACAGCTGGTAAAAAGGAGCGGCGCGAAATATTCGAGAATGTCATTA
ACGTGTTGTCAAATCCTGCCATCAATGACAAGATACTCGGAGGCATATGC
AAGATTGCTTCAATCACGCTGCATCGATATAAGGATACAGCTTCCCAATC
TTACGTGAAAGGGCTGATAGTTGCTATGATCAAACAACATCCAGAAACGG
TTATCAAACATCTAGCTGCTGTTATTACGGAGCAAGCTGTATGGCACAAA
AATGTAGTACCGACTAAAAATACAGCTCTGAGCGCATACTTGGCATTAAA
ATGGTCTACGCTTCTTGTACAACACGGAGCGAGCAAAGACTCGCAATCGT
TGAAAGATGAACTACCAAAGGTGATAGAGGCGCAAGCAAATTTGAGCGCA
GCGGCTGTTGCCTCTATGGACAAAAAGTTGAACGACAAAGTTTATTCTCT
ACTGAGTCATCAGTGGAAAGTATCTGCAAATTCCGATGAAAGGTATCTCG
ATGTGTTGAGCAATCTCGAAGCCAGCAACGGAGTCATAGTTCTTGCCAGT
TTATTCACAAAATACCTGATTTCAAACGACAAAGAAAAGCTGGCAGACAC
ATTCAAGGTAAAGATTTTGGATTCCTTCATAAAGGTAGCTATAAGTTGCA
AAAAAAAGCCACAATTGTACGTGGTCGAAGCTGCAGAGCCATTTCTCCGA
CGGCTGACACACGATGATTTCAAAGATCAGTTATTGCCTGCTCTGCAAAA
ATCGATGTTACGAAATCCGGAAATCATAATAGATTCGGTGGGTCACATAC
TGAGCGGTTTGAGCCTCGACCTGAGTCGTTACAGTGAGGAAATAAGTAAA
GGATTGTTCGCGAATCTCCATTCGAAAGAGGATTCGGTGCGGGAGGCAGC
AGCCGAAGCGTGTCGAAGATTGGCTCTCCAATGTTCGGACACAGCGGCTT
TGGAGAAGCTGCTCGCGTCGTTATTCGCAGTTTTTCACGGTTCGGAGGGC
AAGCTAACGATGGTAACGCACAAGATTTCGGTGTTACAAGGGGCAGGGAA
CTTGAGTCAAAATGCGGCATCGGGGAGCGGCGTTCAGACCGTAGCGGAAG
TGGCTTGCGGGCATTTTATAAAAGTTCTCGAGACAGAGGTGCACGAGAAG
ACGCTTATACACGCCCTCGAAATGATGACACTGTGGTGCGCGAAATTCGT
CAATCAAGTACCAAAGAGCGTGATCGAAACGTTCAAGAAAGGCATGGCAG
CTAAGAGCTCGACAGCGGGTGTGAGGACGGCGTACATAAAGCTCATAATG
TCCGTCAACGTGATATCACATTCGGCGACGTTGTCACCGATCCTGAGTCA
AGCGATAACCCGTGCGATGCAGCAGGCGGCCCAACCGCCGGTGGTAACGG
AGGGTCTCGTCGCTGCGCATTTGCTTCTGAAGCTGGTGATCGCTGGTGAA
GTTGAAAACGACAAGCAGAACGTGCTCTGGAACGCGATCGACGAGCAAAT
CTTTTTCGGTGAAAAATTTTTGTCAACTTGCTCCGACGATATTCTTTACA
ATCTGATGCAATTCTGCGAGAAATTGATAGTCGAATACGCCGATCGGTTG
AACGAGAAAGCCCTGAGCGGCGTTCACAGAGCGATCGTCGCCTGCGTCAC
CGCCCCGAAATCATCGACCCGTCGACGCTGCGCTCCTCTCGCTAAAAAGC
TTCTCACGGGTCTCGGCACTTACGAACCTGCGCAAGCCCTTCTCCTCGAG
TTCAACAAGTTCCTCGAGAACGCCAGGATTTACGAGGGCGATCGGGAGAA
CAAGGACGAGGGTCCGCCGAGCGGCGAAGTCACGGGGCGATCGCTGGCCG
ATGGTTTGCTCGCCGTTTGCTCCGGTTCGTTCCTCTTCGAGCAGCCCGCT
CTCCGACTCGTAACAGATTCGCTGATCCCCGCTCATCATCCAGCGATTCT
CAAGGCCGTTCCGAATCTGTGGTCCAAAATCGTGAAAAACTTTGATCTCG
CACCCCGCGATTTTCTCGTACGTTGTCTCGGTGATGTGAAAACAATGTTT
ATCGATAATTATCGAGCAACGCCTTCGTACGAGAACGCACTCGGTACGAT
AGTCTCTCTGACTCCGGATCTCGTGCTCGGAGCCCTCGTCGCTAACGTAA
CCAGCAAATTGGACGACCCGGAAATTCTGCGGGTCACCAAGGACGAGTAT
TTCACGTATCTGACGCCGGACGGCGAGCTGTACGACAAAAGCGTTATTCC
GGGGAACGACGAGAACGACATTTTGAACTCGATGAACATGAAACGCGAGA
GCAAAGTTTATTCGTTCAAGGAACAACAAGAGGAATTACAGCTGAGACGA
GAGTTGTACGAGAAGAGAAAGCGCGAGGGTAAAATAAAAGAGCCGAAATT
GACAGCGAAACAGGAAGAAGCTTTGAAGAGTCAGATCGCTCGTGAGAACG
CGATAAGAAAAAGGCTGCGTGAGTTTCAATCGAAAATAACGCTCGCCGTG
TCGATGATGAAAGCTGCGATTCTCGGCGACAAATTTCACTCGTCATTTTA
CCTGAAAGATTTGTTGGCACCGATCCTGAAAAATCTCGTGTCCCCGCTGG
CTGCTCCGACGATGTCACAGCTGTACATCGAGTTGGGCAAAATCGTCGAG
ATAACGAAAGATCGAACGATGAGTTCTCTCGTGGCGCATGTAACGCTCAG
ACAATTGGAGCCCCAGTGCGATCTGGAGGCCGCATGGCAAGAGGAAGACC
TCGAGAAAGCGGTTTCGAGGACTTTGAATCTGCTGCACAATTACACGGTG
CGCCAAAAACAATTGTTGATAGCTCCGGCTTTCTGCTACATTTTTCCATT
CGTGATGAAAACCTTGTTGACCTGGAAAGACGAATCGATTATCAGCGAGG
GCCTCCAGATCGTCCAGGAGCACGCTAAGCAGCGCGGGGCTCCGAACGAC
TTCGAAGATCCTCGACACCCGAGATTGCTGCCGAGGAAGCAAATGTTCGA
TTTGTTGATCGAGCTCATGAGCTCGACCGCAGGGAGAATACAATCGCACG
CGGTGGCAACTTTCCTCGACGTCGCTCGATCGGGCAGCGGAACCGCGGAC
TGCGCGACTGCTTCCGGCGACGAGATCGACTCCTTGATGGGTGCGCTGCA
GAACAATTTACCAGCGGTTCGTGACGCGGCCCTCCGCGCCCTCATGATCG
TCAAACTCGCATTCCCCTCGGAGAAGGAAGACTACGAGCAACTTTTACGC
CTCACTCGACGAGTCTGGATCGCCAAGTTCGACACGAGCGACGAGAACAA
AGTTTTAGCTGACGAGCTCTGGGAAGCTTCCGGTTTCGCAGCGAGTCCGG
AAATTCTTTGCGAAGAGTTGATTCAGGACGTCGCCCATCCGGTCGAGTCT
GTGCAACAAGCCGCGGCTCTGGCGATGGCTCAACTGCTCAAAAGCGCTCC
CGAACTCATGCCCGGTATCCTCGACAGTCTTTTGGAACTTTACCAGGAAA
AATTGGCAATGATACCTCCGAAATTGAACGATTTTGGCAGAGTCGTCGAG
CAGCCGATCGACACGTGGGGCCCGAGGCGCGGAGTCGCTCTGGCGCTGGC
TCAACTGGCGCCGTTGCTCACACCCGAAACGATAAATCGTCTCGTGGAAT
TTTTCGTCTCGACCGGACTGGGCGATCGCAACACGTCCGTCCGAACGGAA
ATGCTCGTCGCGGCCGTCGCCGCGGTCGATTATCACGGCAAGGCAAACAT
CACCTCGCTGCTGCCAGTTTTCGAGAACTTCATGGACAAAGCTCCGAAGA
TCGGAAGCTTCGATTCCATCAAGCAATCGGTCGTCATCCTCATGGGCTCT
CTCGCGAGGCACTTGGAGAAAGACGACCCCAGGATAAAGCCCATCGTGAT
GAGACTGATCGCCGCTTTATCGACGCCCTCGCAGCAGGTCCAGGAAGCGG
TGGCCAACTGTCTGCCGCATCTCGTGCCTTCGATAAAGGAAGACGCGCCC
AGGATCGTCGACAATCTCATGGACCAGCTTCTCAAGTCCGACAAATACGG
GGAGCGGAAAGGAGCCGCTTACGGTCTTGCGGGTCTCATAAAAGGCATGG
GGATTCTCGCTTTGAAACAACTCGACATCATGACCACCCTGACCAACGCG
ATTCAGGACAAAAAGAATTACCGACACCGTGAAGGCGCCCTCTTCGCTTT
CGAGATGCTCTGCACGATGCTCGGCAGACTTTTCGAGCCTTACATAGTAC
ACGTGCTGCCGCATCTGTTGCTCTGCTTCGGGGACTCGAGTCAGTACGTG
CGGGCCGCGACCGACGACACCGCGCGCGTCGTCATGAGCAAGCTGTCGGC
TCACGGAGTGAAGCTCGTTTTGCCGAGTTTACTCGCCGCCCTCGAAGAAG
ATTCCTGGAGAACGAAGACCGGCTCCGTCGAACTGCTCGGCGCGATGGCT
TACTGCGCACCGAAACAATTGAGCAGCTGCCTGCCGAGCATCGTGCCCAA
GCTGATCGAAGTACTGAGCGATTCGCACACCAAAGTCCAAGAGGCTGGAG
CCGAAGCGCTCAAAGTAATCGGGAGCGTAATCAGGAATCCTGAGATCCAA
GCGATCGTCCCGGTCCTCCTTAAAGCGCTTCAAGATCCGTCGAGAAAAAC
CGCCACGTGTCTCCAGACCCTTCTGGACACGCAGTTCGTTCATTTCATCG
ACGCCCCGTCGCTCGCCCTGATAATGCCGGTCGTCCAGCGCGCCTTCATG
GACCGTTCGACCGAGACGAGAAAAATGGCCGCGCAGATTATCGGAAACAT
GTATTCCTTGACTGACCAAAAAGACTTGACGCCTTATTTGCCGACTATTA
TTCCAGGCTTGAAAACCAGCCTGTTGGACCCGGTGCCGGAGGTTCGAAGC
GTTTCAGCCCGCGCTCTCGGCGCCATGGTACGAGGAATGGGAGAATCGAG
CTTCGAGGATCTCCTGCCCTGGCTCATGCAGACTCTGACCTCGGAAACTA
GCAGCGTCGACAGGTCCGGTGCGGCCCAGGGATTGTCCGAAGTCGTGCGG
GGTCTCGGAGTCGAGAAGCTGCACAAACTCATGCCGGAGATAATAAGCAC
TGCGGAACGTACGGACATCGCTCCGCACGTGAAAGACGGTTATATAATGA
TGTTCATTTACATGCCAAGTGCCTTTACGAGGGAGTTCACGCCTTACATA
GGACAGATTATAAATCCGATTCTCAAAGCTTTGGCCGACGAGAACGAGTA
CGTTAGAGAAACGGCGTTACGGGCTGGCCAGAGGATAGTTACTTTGTACG
CTGACACGGCGATAATGCTTCTGTTGCCGGAGCTCGAGAAAGGGCTCTTC
GATGACAACTGGCGGATACGATACTCGTCGGTGCAATTGTTGGGTGATTT
GCTCTACCACATTTCCGGTGTTTCAGGAAAAATGTCGACGGAGACTGCGA
GCGAAGACGATAATTTCGGCACGGAGCAGTCCCACTACGCGATTATAAAC
GCTCTCGGTGCGGAAAGGAGGCACCGCGTTCTCGCCGGTCTCTACATGGG
TCGATCGGACGTCGCTCTGATGGTGCGACAAGCGGCGCTCCACGTTTGGA
AGGTCGTCGTGACCAACACGCCCAGGACGCTAAGAGAGATACTCCCGACG
TTGTTCAGCCTTCTGCTCGGTTGTCTCGCGAGCACGAGCTACGACAAGCG
CCAAGTTGCGGCCCGGACCCTCGGGGATCTCGTGAGAAAACTCGGCGAGA
GAGTGTTGCCAGAAATCATACCGATTTTGGAGCGGGGACTGCAGAGCAAC
CAGGCCGATCAGAGGCAGGGCGTGTGCATCGGGCTCTCGGAGATAATGGC
GAGCACCAGCAAAGACATGGTTCTTACGTTCGTCAACAGCCTCGTACCAA
CCGTGAGGAAAGCTCTTTGCGATCCTCTCCCGGAGGTGAGACAAGCCGCT
GCGAAAACGTTCGACAGCTTGCACTCGACCGTCGGAGTCCGTGCCCTCGA
CGACATTTTACCGGCTATGCTGACGCAACTAAACTCACCGGATCAGTCCG
AAGCCGAGAACACGCTCGACGGGCTGCGCCAAGTCATGGCCATCAAGTCT
CGCGTCGTCCTGCCCTATCTCGTTCCACAGCTGACCAGCCAACCGGTAAA
CACGAAAGCACTGTCGATCTTGGCGAGCGTCGCCGGCGAAGCGCTTACAA
GATTCCTGCACAAGATTCTGCCCGCTCTTCTGACCGCGCTCTCGAGCGCC
CAGGGAACACCGAACGAGGCCCAGGAACTCGAGTACTGCCAGGCCGTCAT
ACTCTCCATCACGGATGAGGTCGGCGTTCGAACGGTCATGGACCAACTGA
TGGACGCGACGAAAGCCGACGACGTGTCTCGGAGGCGCAGCGCGGCCACG
TTGCTCTGCGCCTTCTGCAGGGACACCCGGGCCGACTACAGCCAATACGT
GCCGCAGCTGCTCCGCGGCCTCCTGCATCTTTTCACCGACGAGGACAAAG
AGGTTTTGCAAAAGAGCTGGGAAGCTCTGACCGCCGTGACGAAAACGCTC
GGTTCCGATCAACAAATCGCTCACGTTCAAGATATTCGACAAGCCGTCCG
CTTCGCCGTCTCCGATCTCAAGGGACAGGAATTGCTGCCCGGCTTCTGTC
TGCCCAAAGGCATCACTCCCATTTTACCGATCTTCCGCGAAGCGATCCTC
AACGGCATGCCCGAAGCGAAGGAACAGGCTGCCCAGGGCCTCGGCGAGGT
GATCAAATTGACGAGCGCCAACGCCCTCCAGCCCAGCGTCGTCCACATCA
CCGGACCCCTCATCCGCATCCTCGGCGACCGCTTCAACTGGAGCGTGAAA
GCCGCCGTTCTCGAAACACTCGCGATTCTCCTCGGCAAAGTCGGCGTTAT
GCTCAAACAATTTTTGCCACAGTTACAGACGACCTTCCTCAAGGCTCTCA
ACGACAGCAACCGCCAAGTGAGGCTCAAGGCCGCTTACGCTCTGAGCAAC
CTCATCGTCATACACACCCGCGCCGATCCTCTCTTCGCCGAGCTCCACAC
CGGCATCAAAACTTCCGACGATTCGGCCATCAGAGAAACCATGCTCCAAG
CCCTCCGAGGAGTCCTGACACCCGCCGGCGACAAGATGACCGAGCCCATG
AGGAAACAGGTCTTCGTCACGTTGAGCTCGATGCTCGGACATCCCGACGA
CGTCACGAGAACCGCCGTAGCCGGTTGTTACGGCGCTCTCCTCCGGTGGC
TCAGCCCCGAACAGCTCGCCAACGCTTTCAACGAAAATCTCCTTTGCAAC
GACGCCAACGCCGATTGGATGCTCAGACACGGTCGCTCCGCTGCCCTCTT
CGTCGTTCTCAAAGAATCCCCAGCCACCATTTACGCCGCTAACGAGGAAG
AACGCGCCTGCAAAGTAATCCTCTCGTACCTCGCCGCCGACCGCGTACAA
ATCGCCATGAACGGCGTTCGCGCCTGCGGATATCTTTTCCAATATCTCAT
GATGGAAAATCTTCCTATCCCAATCGTTATCCTCACTCCCTTCGTACGAT
CCATGAACAACAACAGCAACGACGTCAAACAACTCTTGGCCAGGGTGTGC
ACTCACATCGCCCGGAATATTCCTCCGAGTAAAATGTCACCGGAACTTCT
CAAGGCCCTTATTCCCATGCTGGTCAACGGCACCAAGGAGAAAAATGGAT
ACGTCAAAGCCAACAGCGAATTGGCTCTCATTGCTGTTCTTCGGCTTAAG
CAGGGTGACGAGGAACAGCAGCGTTGCATGGCCCTTCTGGACGTCGGAGC
ACGAGAATCCTTGTCCGACGTCGTGAGCAAAGTATTGCGAAAGGTGTTGT
CCCAGCCCGAGGGCAAGATAGAAGAGCTGGACGACACGTTACTCACGTGA
back to top