g75.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg75.t1
Unique Nameg75.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:556244..556561 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g75g75Venturia canescensgenescaffold_1 556244..556561 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g75.t1-start_codong75.t1-start_codonVenturia canescensstart_codonscaffold_1 556244..556246 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g75.t1-CDSg75.t1-CDS-1Venturia canescensCDSscaffold_1 556244..556561 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g75.t1-exong75.t1-exon-1Venturia canescensexonscaffold_1 556244..556561 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g75.t1-stop_codong75.t1-stop_codonVenturia canescensstop_codonscaffold_1 556559..556561 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g75.t1g75.t1-PAVenturia canescenspolypeptidescaffold_1 556244..556561 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g75.t1 ID=g75.t1|Name=g75.t1|organism=Venturia canescens|type=mRNA|length=318bp|location=Sequence derived from alignment at scaffold_1:556244..556561+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGTTTTTCGAGGCATCTGCGCGGTGTTTGTCGTCGAAGGGACCGGAAGA
GTCGATCGACGACGAGGAGCCTGAAACTCCGCGGCGCGATACCGTTTGTC
TTCGCATCGAAAGGTCGAAGGCTCCGAGCCGCGGGAGCAAAAAACTAGAA
GCTCGAAGCAAAGAAGCAGCGTCAAAAGAGCCTGCTTCCCCGGGGTCCGT
ATTGACACTCGAAAAATCGAGCGTCCGAGCTCCCGCTCGCAACGGAGGGC
CGCGGCCGCTGAAAAGGCCCCGGACTTTGGCGCCGTCGTCCTCGACGAAC
CTTTTTAACATCAAATAA
back to top

protein sequence of g75.t1

>g75.t1-PA ID=g75.t1-PA|Name=g75.t1|organism=Venturia canescens|type=polypeptide|length=105bp
MFFEASARCLSSKGPEESIDDEEPETPRRDTVCLRIERSKAPSRGSKKLE
ARSKEAASKEPASPGSVLTLEKSSVRAPARNGGPRPLKRPRTLAPSSSTN
LFNIK
back to top

mRNA from alignment at scaffold_1:556244..556561+

Legend: start_codonpolypeptideCDSexonstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g75.t1 ID=g75.t1|Name=g75.t1|organism=Venturia canescens|type=mRNA|length=318bp|location=Sequence derived from alignment at scaffold_1:556244..556561+ (Venturia canescens)
ATGTTTTTCGAGGCATCTGCGCGGTGTTTGTCGTCGAAGGGACCGGAAGA GTCGATCGACGACGAGGAGCCTGAAACTCCGCGGCGCGATACCGTTTGTC TTCGCATCGAAAGGTCGAAGGCTCCGAGCCGCGGGAGCAAAAAACTAGAA GCTCGAAGCAAAGAAGCAGCGTCAAAAGAGCCTGCTTCCCCGGGGTCCGT ATTGACACTCGAAAAATCGAGCGTCCGAGCTCCCGCTCGCAACGGAGGGC CGCGGCCGCTGAAAAGGCCCCGGACTTTGGCGCCGTCGTCCTCGACGAAC CTTTTTAACATCAAATAA
back to top

Coding sequence (CDS) from alignment at scaffold_1:556244..556561+

>g75.t1 ID=g75.t1|Name=g75.t1|organism=Venturia canescens|type=CDS|length=318bp|location=Sequence derived from alignment at scaffold_1:556244..556561+ (Venturia canescens)
ATGTTTTTCGAGGCATCTGCGCGGTGTTTGTCGTCGAAGGGACCGGAAGA
GTCGATCGACGACGAGGAGCCTGAAACTCCGCGGCGCGATACCGTTTGTC
TTCGCATCGAAAGGTCGAAGGCTCCGAGCCGCGGGAGCAAAAAACTAGAA
GCTCGAAGCAAAGAAGCAGCGTCAAAAGAGCCTGCTTCCCCGGGGTCCGT
ATTGACACTCGAAAAATCGAGCGTCCGAGCTCCCGCTCGCAACGGAGGGC
CGCGGCCGCTGAAAAGGCCCCGGACTTTGGCGCCGTCGTCCTCGACGAAC
CTTTTTAACATCAAATAA
back to top