g76.t1 (mRNA) Venturia canescens

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
Nameg76.t1
Unique Nameg76.t1
TypemRNA
OrganismVenturia canescens (vcanescens)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:557932..569526 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
g76g76Venturia canescensgenescaffold_1 557932..569526 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
g76.t1g76.t1-PAVenturia canescenspolypeptidescaffold_1 557932..569526 +


The following start_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g76.t1-start_codong76.t1-start_codonVenturia canescensstart_codonscaffold_1 557932..557934 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g76.t1-CDSg76.t1-CDS-1Venturia canescensCDSscaffold_1 557932..557941 +
g76.t1-CDSg76.t1-CDS-2Venturia canescensCDSscaffold_1 558269..558422 +
g76.t1-CDSg76.t1-CDS-3Venturia canescensCDSscaffold_1 566465..566774 +
g76.t1-CDSg76.t1-CDS-4Venturia canescensCDSscaffold_1 568006..568152 +
g76.t1-CDSg76.t1-CDS-5Venturia canescensCDSscaffold_1 568900..569526 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g76.t1-exong76.t1-exon-1Venturia canescensexonscaffold_1 557932..557941 +
g76.t1-exong76.t1-exon-2Venturia canescensexonscaffold_1 558269..558422 +
g76.t1-exong76.t1-exon-3Venturia canescensexonscaffold_1 566465..566774 +
g76.t1-exong76.t1-exon-4Venturia canescensexonscaffold_1 568006..568152 +
g76.t1-exong76.t1-exon-5Venturia canescensexonscaffold_1 568900..569526 +


The following intron feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g76.t1-introng76.t1-intronVenturia canescensintronscaffold_1 568153..568899 +


The following stop_codon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
g76.t1-stop_codong76.t1-stop_codonVenturia canescensstop_codonscaffold_1 569524..569526 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>g76.t1 ID=g76.t1|Name=g76.t1|organism=Venturia canescens|type=mRNA|length=1248bp|location=Sequence derived from alignment at scaffold_1:557932..569526+ (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon.  
ATGGTGATAGAAGAAATAGCTCACACCAACGGCTGGCTCGTGCCCCCCAG
TCCCGGGGCAGGACCCTCGTTGCCTCACGGCGTCAAGATCGAGCTCCAGA
ACAAGAAGCTTTGGCGGCAATTTCACGCGGAGAGTACCGAAATGATAATC
ACGAAGCTTGGGCGGCGAATGTTCCCCGCCGTCCAACTGAACGTCTCCGG
CCTGGAGAGTCGCGCCCGTTACTGTCTCCTGCTGGAAATAGCTCCGGCCT
CCCGCCGCCGTCACAAGTACGTGGGAGCGAGCGGCGAGAATTCGTCGACT
CCTGGGACAACGCGGGGCTGGACGTCGGCGGGGCCGGCGGAGCCGCAGCC
CCGCATCAACCGGAGAGTTTACCTCCACCCGGACAGTCCTGCGACGGGGC
ATCACTGGATGCAGCATCCGGTCAGCTTCGGCAAGCTCAAGCTGACCAAC
AACGCGGTCGATCACCACAACAACGTGGTCCTCACTTCCATGCACAAATA
CATACCCAGAATATGGATCATTCGATGCGACGACCTCGCCAACATGAACA
ACCTCTACAGTCAACCTTCCGCCTCGTTCACCTTCGACGAAACCGAGTTC
ATCGCTGTCACCGCTTATCAGAACGAGAACATCACGAAGCTGAAGATCAA
CAACAATCCGTTTGCGAAGGGCTTCCGAGAGACGGGTCAGTCGCGCTGCA
AGAGGAAACTGCATCAAATGAACGAGAGGAGCGAGTCGAGCGCGGAGGAC
AGAAGCGCCTGCGAGGAGGAGGAAGAAAACGCATCGTCGTCGGAGTCGGA
GTCTCATAGGCCGAGGAGAAGTTCCGAGAGCGAGGGAAATCGGCCGAGGA
GAGCTCTGAGCGAGGCGGGCAGCTTGGACGACAGCGGAGTCAGCAGCTCC
GGAGGAAGCACGCCGCCGTTGGCCCACTCGCCGGGGAATTACACTCGATC
GCCGTTGCGGACGCAGGAGAACGAGCGCAGAAGCGAGAGCGCTCAGCAGC
CGGCGCGCCTGCACAGACCGTGGGCGGACTCGTCGTCGCCGACTCAACAT
ATTCATCACCGAGTCCAAGAATCTCCGTTAGCGGCACCCTCCGCCACTCA
CCCAGCACTTGACTTTCATCTCTTCAATCCTTTTCTCCTTCCTTCCTCGC
ACCAGCATCACTTGGCGGCGCTGGAAATCGCGAGGTTCCAGCATCAGATG
CAACAGCATCGATACGCGAGCCAACATCTGGCCAAATTCTATCGCTGA
back to top

protein sequence of g76.t1

>g76.t1-PA ID=g76.t1-PA|Name=g76.t1|organism=Venturia canescens|type=polypeptide|length=415bp
MVIEEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMII
TKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSST
PGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTN
NAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEF
IAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAED
RSACEEEEENASSSESESHRPRRSSESEGNRPRRALSEAGSLDDSGVSSS
GGSTPPLAHSPGNYTRSPLRTQENERRSESAQQPARLHRPWADSSSPTQH
IHHRVQESPLAAPSATHPALDFHLFNPFLLPSSHQHHLAALEIARFQHQM
QQHRYASQHLAKFYR
back to top

mRNA from alignment at scaffold_1:557932..569526+

Legend: polypeptidestart_codonCDSexonintronstop_codon
Hold the cursor over a type above to highlight its positions in the sequence below.
>g76.t1 ID=g76.t1|Name=g76.t1|organism=Venturia canescens|type=mRNA|length=11595bp|location=Sequence derived from alignment at scaffold_1:557932..569526+ (Venturia canescens)
ATGGTGATAGGTTAGAAAAAAAAGTACTATTCCACAGTTTGAATTCTAAA GAATTTTTTTATATTTCACGGATAAATTCCACCTAAAAATGAGGTATTTT TGGGGGTTAATCCCGCATAAATAAAGCAAACCTAGATAATTTAGATAAAA ACAATTATAATATAATAATAAAAGTTTTAATAAAAACAAACAAACAGAAT TTGGAAAAATGGCAGAAGCAGAAGCTTTTCCAGTGTCACTGAAAAATACG CTCACGCGAAGGGAATACCTTAAAAATCATTCTCGTCTCGGTATTTATTT CTCTACAGATTTTGATAATGGTTTTTTCCTCTTCCAGAAGAAATAGCTCA CACCAACGGCTGGCTCGTGCCCCCCAGTCCCGGGGCAGGACCCTCGTTGC CTCACGGCGTCAAGATCGAGCTCCAGAACAAGAAGCTTTGGCGGCAATTT CACGCGGAGAGTACCGAAATGATAATCACGAAGCTTGGGCGGTGAGTAGA AACGAAATTTCGATTTATAGATTAATTCGTAAGAGGATATCCTCGTGGAT GAAGTCGAGGCGACGATCCCGAGTTTCCAGACGACGATCGTCGCCTTGAA ATTCTTTGAGAAATAATTTGGCTCTGCGTCAAGCCGAAAACTTTGGCGAA GGTATCGGTGGCCGGAAAAACTGAAAAGGCCTACACCGCGCAGAAGATTT TCGGTTCTGGCTCCTTGGCAGTGGCTATAATCCCCGAGAAGTCCGAGCTG CGTGAGGGCTCTCGCGCTCGCCGGTCTCTTTCGGCGTTCACCGCATTCAT AAAGGGAGACTGCGCAGCTCATTACCGAGGGTAAGCGATACTCGGACGTT TCTCATTGAGAAAAGTTATCCTAGCGCGACAGAGCCACGGCGAGGGAGTC GCGGGCGTAACGCACACTCTCCGAGGGCTCGGCTCTCGCTTTTCTTTCAT CGATCGAACGAGCGGACGGAAGCTCGAAGCTCCCGCAATCTCTCGACGCT CTTCTCGCTCTCGCCTCGGTCTACGAGTTTTCGCCAGATTCGCACCGTTC CCCGGACGAGCTCGCGGAGGAGGAAGAGCGAGAGAGAGCGTCGTAATAGC GGGGAGAGTCGACGACGAGGCCGCGTCAGGTCTCGGGCCCGTCGCAATCC TCACGCTCGAGGGAGCAGTTCGATGCTCGACAACGCTCTTCTCTCTCTCT CTCTCTCTCTCTCCGCCTCGTTCCCCTCTCGCTGCTGATGGAAGACGAGG AGCGGCGTGCTCTTTGAAACTGACCGAAGCCCACGGAGGATCTCTCGTCG AAATCTTCTCTTAATTAGCCGCGTCGACGTCCCGCGAGCTCGCGCGCCCT CGAGATAAGAAATTCTCGATTTCGCCTCCCCCTCCCTCGTATATTCACTT TGTACAATATTTCCGTGCGTTTCCATTCTTCCCCATATGACGCTTCTGCG CTCGCGAGTCCGGATTTTTCCACGGATCATCGCGGAGCGAGAACTTCGCG GTTCTCTAAAATCCCGAAAAGCGAGCGTCCACCCGAGTCGACAATCGCCG TACTTTTTCTTACGAATTCAACGACCTCCCGCTACCCGCGCTTTCCGATC TTCGATCCGCGACGCGAACGTCGTCAAATCGAGGACGTTCCTCGGCTCGC AGCGCTCCATACGAATACACGCACACGTTTGGACGATCGTTCGAGATCAT AGATCGGATATAATAAATTGAATAAGTGGAATGCCCGAGTCTGCCTCGGA GATGCGAAAGTATGCGCATTTAAATCCCACGCTCACAGGGGGTCGTCGAG GACTCGTCCCCGGGTCCCGCGTGTGCTCGCGCTCTGCCTCCTCTCCTCCC CCCGTTCCACGCTCCTTCGAGGATCAGCCTGTATTCGGCGAGCATCACAC AAAAAGAGAGAAAGCAAGAGGCCGCGGGAGAGGGAGATGCTCGGACCAGG TCATCCTGGAGCCGGCAGCAGAAGCAGACAGTCGCCGGCGCCTCAAACTA CTTTTCTTTGTCTCAACGGCCGCCAGCGCGGGCGCGAGCCCTGAGACAAG GCTTCCATTCTTTTTCCATGTATTTCCTCTCCTTTACGGCGCGCAGCATC ACCCGAATTAGGGAGCGAGGGCGCGGGGGGAGGAGGAGAGAGAGGAAAAC GAAGCGCCACACGCCGTGAGGCTCCCTCCGATTTTTCAAATTATATGTAT TTATCCCAACATATATTTGGCCATTTTACACGAGCTTGTTTCGAGCCTCG TCGTTTTCTCCTCGTCCCGTGAGCCGACAAATAAATTCGTCAGTTTGTAG CATCTCGTGAGAGCCTGGGGCACCCGCAGGTGGATTCTCCGCGTCACAAT CGCGGTTGCGCCGACTCCGAAAGGGCGTTCTCATCAATAATTTATCAGGT TGATTAATTGGCGATCGTGAAGCCCGAGAATTTGGGAAAATGCCTGAAAT TCCCGGTGCCGAAGCTCACCTTGAGAGCAGCCTGCTCCGCAGACGTTTCG AATAATATTTTCCCTACAAAATATACTAGCTTCGATATCATTCGTGCGAA GACGTCGATGCGCAAGAAGAAAACCGTGACGTCCAACATGGAATGTCGTA CGCGACGACGAGACGATTAGTTTCGCCGGAGGTGGCCCCCAAAACTCGTG CGACTGTAGCGCTCGCACATACCCATTTTTACTCGGGAACGGAGAGGAAT GAGAGAAACACCGATTAAAATTGGTTAAGGCTTATCGCCCTAACCCATCT CTCCGGTCCACGCTGACGCCAGCTTCTCAGCGCGCCATTTACAAGGGTGT AGACACGGGACACGCATGCACTCTCCTGTGCTCGTGGCCACAGATATATG GCGAACGGAGAAAACCGACCGTCAACTCTCGACAGGTTTCCACGGGGAGG GGTGGAGCCCCGGAGATTTCTCTCTCTCTCTCTCTGTCTTCGTGCTCCTC GCAAAAGCTAATCGGCGAAGCTTTTCCGTGGACAGCGACAGTGATTTCGA CTGTCTTGGCACTCCCGCTGAGTTTTCCGCATTTTAAGGAAGCTATCGCA ACTGCTACGAATTAAATCGAAATTCTTTGTCAAACTCTTTCGGAGAACTT TGATTTCGAAAATTCCAAGCGAGGTTAGCCGACCGATGCGCACTCTTGAG AGCTGAAATTTAGATATTTGCTAGCAATATCCCCGGAATTATTACAGAAT CTAGCGTCCAGCTGTCGAGACAATTATTTACGAAAATCACATTTTTTTCG ATCTAGTTAAATTTGGATTTAATTAAATAGAATCCTCCCAACTTTGAAGA GCCAAAAACGGAGAATAAGAAAATGGAATGTTTTTTTATATCAATGACGT CTTGAGAAAGCCTTGTTACCGGTGAAAATGACTTGGGAATGGAAAAAGAA AAAGACTGATTCGAGGTTAACGAGTATATAATGACGACACAAACGGTGGA AGGTTTGACAACAGCATGAGCCGCGGCTGGTTTAAGGTAACTCCTGCGCT GCATCCTAGTCAAATGAGTGCTAAATTTTCAAAACGCTTTTACACCAAGT TCAACGTACTAATTAAACTTATCGTTAGTACATGTGTATTCAAGCATATT TCATTAACGTGAAAAAATATTAAAAACGATAGTTTTGCAAAAATATCAAC TGACAGATGCAAATTTCCATGATGACACATTTTCACAAGTATTTTTCAAA GAATCATCTGTATCTTTTAACCGATTTTATTGCGCCAAGTCTCATTTTGT TCCTCAACTGATCCTCTACGAATTCACCACGTAGATTTTCCTTTAAACTC ATTCCTGAGAGAAATTATTAATGAAAAAGTTATTTCTCTTAATGAACAAT TATAGCTGCAACAGTGAAACGATCGAGCTAAAAAAACAACTACATGATGG ATTCACAGAGGACCGGTTGACGAACAAAACGAGACTCGTTGCAATAAAAT CGATGATAAAACGCAGATAATTCTTTGAAAAATACCAGTGAAAATGTGTC AGCGTGGAAATTTGCATTTATCATCAGTTGATGCATTTGCAAAACTAGCG TTTTTAATATTTTTACATTTTAATAAGATATGCTGTAATACAAATCCACT AACAATACGTTTAATCGGTACGTTAAACTTGGTCTAAAAGCGTGTTTTGA AATTTAGCACTCATTTGACTAGCATGCAGTAGAGGAGTTACCTTAAAAAT AGAAAATGGCTGTTGTGACATTTTGCTTTACGATTTTACTACGAAAGTAT TTAAATCGCTGTCATATTGAAAATTGATCAATCTCAATAAATAAGTTCCA CCGAATTTTAATAGTTGGGAGAATAAATTTTGATCGTTTCCTTCATCATA TGAAAAGAGTAAAAAAGTTCAATTGCTTTTTTGAATAACGCGTGTAAAGC ATGATCTTGCTTAAATACGCGTCGTGGGTCTGAAAATAATTGCTGAATTT TGGACTCCCGATGAAGTTCGAGTCCAGGGGAATGGAGTTGGTCGACGAAA GGAGAAAAGTCGGGAAGATTTTTGATGATTCGAGTTTTCCTTTTCGGGCT CCGATCGAGAGCTTTCAGCGTTGAGAGCCCGTTGTTGATCGAGCGAATCG TAAAACTTTTCTGACGCGCTCTGGATATAAATACTTGGGCGACGCTCTGG GACCTTCCTTCCTGTCGATCTTGCGAGTTCGATAAGAGAAATTCGTTGGA ATTCAGCGTACGACGAAGATAGCGCGTGGAGCGAGACCAACGAAGATATT GGGTTTGTAGGAAACGGAAACGGAAGCGCCCGCATACGAGCCTGACTCTC CGCTTGTGTTTGGAGTTCTCGATAGAGTTCTTGAAAATCGGTAAAGAATC GGACGAGTTTGCCCACTCGTTCGATGCCTGTGTCACGTGCAAGCGTTTAC GCACGCTTTCATCCTCCACAGACGCTCCTTTCGCATCTCCTCGGGCTTTC TAAGCAGGGAAAAAGGTTTCTGCGGGGGCGATTCTCGTCTGGCTTTCGAC AATGAGACCTCCGAGACATTTATACGTCGCATGATACGCCCAGGGTGGCA ATCGGCTGCGGAATCTCTCGTAACCGGTGAACAATCACGAGAGCGGAGCA TCTTCTCTCCACGTGGCGAGCATGTGTCATCGGGGCCCTCGCAGTTGCAC CCGCGTGCGCGGCAGCAGCGGTGTAACTGATCAGTATTCCGAGGCACGAT CGCCCCTTTTTCTCTTTTCCCTTCATTCTCTTCGCAGACTCCCCCGCTGT TTAAAACTCATTGAAAAAGTGCAACAATGCCGCCGCTTTGCTGGCTTTTC TCTCGCGCTCTGCCCCCGCCTTTTTTCATTCGATTGCTCGCCCCCCGCCC TCGGCCATTTCCGCGGCCGCACTGAATCGCCGAGGAAACGTGGTCGCCAT AAGTTTCCACGGGCGATTTTGTGCGCGCGGCCATGCGGCGACTTGGTCAC GCGCTTTCGAACGCGATCGAGTGAACTCCCGAGCCTGAAAAGCGCCGGGT TTTTGCGTCCTTTTGTCACTGGCCGAAGCTCGCACTCGCGAGGGAAGATC GCGACTCTCCGGGCGACGAGAACAATCGAGATTTCGGGCTTGCCGGAACG GCGCCGGGATCAGCTGCCCCAGCAGGACGCGGAGATACGCGCGCTCGCGT TTTCTCAAGCTGGGCGCATCAATCTCTGGCCGCAGTCACAGGTTTCTCGA GATCGCGACGACCGGCGAGGACTCCCAGTGCGGGCCTCTCGTCCGTGTCG TGGACCACCACTTTGAGGCGCCTGCGGAGACACCCACTCCGACGCGACTG ACTCAAGGGCCTCGCTCGTCTGCGCGCTCTCTCGCTCTCGAGTCGCTCCT CGTGTGCGGACCGAACCCTCCGAAATGTCGCTCATTTCTGCCCCATTTTC CTTCCTCTTCTTCCGCAACCTTCGAGAGCCGCTGAAAAGGCGGGAGAAAA CGGCTTCGCGAGAGGGAAATTTAGCGTCGCAATTCGTCCGGACCCAGAGC CGCGGAGGACGCAGAAAGACTATAATGGGCCGGAAACCCCGATTGTTTTA GCCTCCGCGAGACCCTTGCGAGTTTCCCCACCACGATCAACCCTTAATTG CACTTGTCGTTAGCAGTCGTCCTCGTCGGCCCCTTACCTGGGACCTCGCG AGGCCTTTATTTGCGCTCCGACCTCAAACATCGCTCGACACATCTTTGCG CCGAGTCTCCAGGTTTTCCCCGAGAAAATGCTTCCCTCCTTCCGACCAGC CTTGCCCGCGCTCCAATTTCTCGCCGATTTTTACCTCCGGCCTTTTCACT CGTTCTTGGCGACTCTTCCCTCGCTATTTCCTCCTCGCCTTCCCTTTCCT CTTCGTAACCAACTTCGACTTTCGAAAATTTGTCACTAATTGTGACAAAA CCCCGATCGAATCGATCACGATTCCGAAATCGGGGCAAAGGGCAAGAAAA TATCGTGCTCTCTAGAAGCTTGAGAAACTTTGTCCACTTTTTACTTCCGA AGAGCAATGAATTGACTGTGGTTTTTTTCAATTTTCGAATGAAAACAATA TTTTCGTGAAAAACTTGAAAATTTGTCAATTTTTTTTCACTGATACTAAA ATCCAATGGAAATTTTAAATAAATTCAATTCGAGAATGATGAAGCAAATT TTATAAATTAAAGTGTTAGAAAAATTCAATTTTTTTTCATTATTGCAAAA AACTAAAAAATTTGAAGAAAAACAACAAAAATTTTCGTAGTTTTTCGAGA GCCCCGTTCTGCCCCAGTCTCCGAAATCTGTGCGGGATTTCAAAGTCCGA TTCGCACGAAGAGTCGCAACGTTTCAGTCGTTCTCAAATTTTTTATCAAA AATGAAAACGAATTATAAGCAAAATTGAAGTTAAGAAAAAATGCGTGACG ATTGTTTTCCATTTCGAGGGCACCGAGAGAATTTGTTTTTGGCTATTTGT GGAGGCAAGGTGGAGTGGAACGTTCGAGTGGACGGGTCAAGAACAATTTT TTTCCTCCGAAAACAGACAAACGCACAAATTTCGGTGTCCCAAGGGAGCC GCCTACGACGCCTGCTTCCCCGATTCAGGTATAGAAGTGCGCGTCGTCCG GCGACGCTGCTCGCTCATCTTTCAGCCCTGAGCACACACACACGCACGTG GAGGGACGCACACACATTTAAGGGAGAGCACTCATCGCGATAGATCTTTG GACGCGGTCTCGTGACGCCACAAGAAAACGTCGCTGCGTCCCTCCCAGCT CTCTGCGTGGAAGCTTTTGCAATTATGTACGTAAACACTCAAGGCACATA GAAGATTCCTCGAGGAACGAGACCGAGGAGTGCCGGGAGGGAGGGGAGAA AAAATGGGGAAAATTGACTTTACGGACTTGACTTACGGATTAGCCGAGTT TGAAATGTTTACACAGGGGAGAGCCAAGCGATGGGATAAGATCAAAGGAT TGCTCGGATCTGCCTCCGACTTGGAGAACAACTGTGCTCCTTTCCCCACG TTCCAAGAGCGTGGACAACCATTTTCGAATCGCCCCTTTGGCTGCCCCCG CTTTCTTTTAATAACGAGAAACCCCCTTGATTTTGAGCTGACTCCGAAGA GAGCTTTCATCCTCCCAATTGTGGTTTTTCCAAAAGAAAATAAGGATCTG GCCTCGCCCACTGTGACTCGACAAAAAATCTTCTTTCCACTTAATCTCTC TTCCCTCCTTCTCCTCCTCCTCCGTAATCTCGTTCGTGGCGCACGCCAAA GTGGCTTCTGGCAAACGAGATAGGAATAAGATAATGGAGAGAAAAAACGA GAGGCGCGCGAGTGTCACGAGCCCCGCTAATGCGTGTAATCACACGCTCA GCGGCCCCGCGTGTTCGTCGCCAGATGCCGGTCGCGAGCCTTCACTTTCG ACGAAATTTCTCCTCCCCCCGCTCTCCTGTGCTCTGATAAGAAAAAACGC GCAAGCGAGGACAGCACGTTGCCCCGGAGTCTTGGCCTGCTGGAGCCGCT TTTTTCGGGGCGCATCGGTCCGCCCGCGATTGGCCAGGATCTCGGGCGCG CGATGAGCTCCGAGAAATCGCGAAAATCCGGCTGACGCAGGAGCCGAAGC TTCGGGAATCTCTGTCTCGACGACAAATCTCGAAACTTTATCTCCCTCAC GAAATTCGATAAAATCGAGCCCGCCCCGGACGATCACGTCCGCACGGGTT TAAGGATTATCACGGACTCGGTGACTTATTGGGGAATATATGTACAGAGC CCCGGCACTACGGAAGCCCTCGGGGCCTCCCCCGGGACTTTGGGACTTAG GGAAAACCGGAGCACTCTTTGGGCACGCATTGGCGTACGGGGGAGCGACG CTCACGTAATTATCGTGCAAATCCATGCAATTTTCTCGAGCGCCCGATCA CGGGGAGGGACGAGAGTCAACGAAGGGAAAAAACGCGCTCGGAAGGAACG ATCTCGCAAGGAGCGTTCGAACGATTCGAGTTTCGAAGCAAAACGCGCAG AAGCTTACGAAGGATTTTCTTGTTTTTTTCCAGGCGAATGTTCCCCGCCG TCCAACTGAACGTCTCCGGCCTGGAGAGTCGCGCCCGTTACTGTCTCCTG CTGGAAATAGCTCCGGCCTCCCGCCGCCGTCACAAGTACGTGGGAGCGAG CGGCGAGAATTCGTCGACTCCTGGGACAACGCGGGGCTGGACGTCGGCGG GGCCGGCGGAGCCGCAGCCCCGCATCAACCGGAGAGTTTACCTCCACCCG GACAGTCCTGCGACGGGGCATCACTGGATGCAGCATCCGGTCAGCTTCGG CAAGCTCAAGCTGACCAACAACGCGGTCGATCACCACAACAACGTGAGTT ACCATTTTCCACTCTCATTTCCCAACGATCCTCTCGATTCCTCGCGACGG CGAAGGGGCGACTCGGACGAGTTCGATCGACCTTTGGCCGTTCACCGGGC GACCGAAGGTGCTCGCGCTTTTGGCTCCTCGGAGTCCTTAGTTTCGGGGG CTCCTTCATCGCGGTGGGAGTTTCAAATGTTTGGACAGCTTGTCGTCGCT CCTCCGGTTACGGAGTCTCGTTCGGGGTCGGGAAAACATGCTGGGAGAAG TCGGGGGGCGCCTGGGGGGTCGGAATTGCCACACGCGTTACGCGACACAT CCGTAGGGAAAGCGATTTTTTTCTCCCCCCCCCCCCCCcNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNGACTCCTTATCCGGGGATGCATT AGGACTACCGTTTTCGGATAAGCGGCAAGAAAATCCGCGTTCCTCCGGAG CTTGTCGCGGGAGGAGCGAGCCACCGCTCGATCGGGCCTCGGGCACCGAT TAATTTCCTTTGGGAAGAGATAAAGAAAGAAGGTGAATCGAGAGAGATTA GAAGCGAGGCGCGGGCGCCGTCGTCCTCGCTGGGAACGAGCGCGAGGCAT CGATCGGCATCGATAAAAAGGAGTGAAACTTCTCCGAACCCAGAATCCCG CTTCCGGGAACACACTTTTTTCTCCCACTTCGTACACTTGGCCATTGAAA CAAAGCAAAAAGCCAGCAAATTAGGAAAAATAATTCGCTCTTGAGAATCT CGAACGAGGAGAGACCGAATTACGAAGAAACTCGTCTGTCCTCCCTCGAA GGTTCTTCTCATGCTTCCCCATCTCTCTGCCTTCTGCGGTCCCCCTTCGC GCACACCACTGCATGAGCTCGTCTCTCAGAAAAAACGGCGCCAACTCGTG TCTCTCGGGCGGTCCAGCGACGGCGGCGCGCCGCGGTTTCCCTTGATCCT TCCCCCCTCCCTCCCGCCCCCCTCAAATAATCATTATTTCAATAAAAATT CCTCCATTTAATCGTAATTGATTCATTGACTCTTATCTCTCTCGTTTTCT CTGTTCTCTCTCTCGGCGCTCCAGGTGGTCCTCACTTCCATGCACAAATA CATACCCAGAATATGGATCATTCGATGCGACGACCTCGCCAACATGAACA ACCTCTACAGTCAACCTTCCGCCTCGTTCACCTTCGACGAAACCGAGTTC ATCGCTGTCACCGCTTATCAGGTAAGAAACGCTGATGAAACACGATCGCG AGTGCAATTTCGAATACGAAGGGCCTTCAAATTCGAGAAAACGGTTTTCT TTATTTCGCCGACTCTCGAGGCTGCGAAAAACTGGTTCAAGTTGGTCGAA AATTCGAAGAAGGAAAATGTGGGTGCGCTTGGCAGCCAGATCTTTTGGCT TTTATCCCAAAACGTACAGAGTTTTTTAATTTGAAGGGTTTGCTCATCGG TACTTCAACTCTATGATTGAATTTTTAAACTCTGTTCGTTTGAGATGAAA AAACGAAAGAGCGCGTTTTGATTCGCGAAGCAGTGGCTACCCCTGAACTA TAATCATACAGAAATATTAAAAATTCAATGATTATTGGGCTTCGAAGCTG AAAATGTCAATCTTCAAAATGTTTCAGAGCACGAAAATCATTCGGTTTTT GAAATTTCTGTGTGATTCAAGTTCGGGCGGTTGCCACTGCTCTACGAGTC AAAGCGCTCTTTGGTTTCGTCATCTCGAATAAGCCGATCCCCCGAAATTG TCGAGGCCACAAAGAAACCGTAGAGTAGTAGTTTTGCACGGAATCTAGCC GAGATACGAGAATTTAAAAATTCTATTGTGCAGTTTAAATACGAAAGAAT AAACCCTTAAAATTTCAAAAGTCTGTGATTTTTTCCCTCCTCGGGAAAAA GTCGCAAAAAGTCCGGCTGCCACATTTGGCGAAGCTCTAACGAAAATGTT GTTTCCTCGTTTTTGTAGAACGAGAACATCACGAAGCTGAAGATCAACAA CAATCCGTTTGCGAAGGGCTTCCGAGAGACGGGTCAGTCGCGCTGCAAGA GGAAACTGCATCAAATGAACGAGAGGAGCGAGTCGAGCGCGGAGGACAGA AGCGCCTGCGAGGAGGAGGAAGAAAACGCATCGTCGTCGGAGTCGGAGTC TCATAGGCCGAGGAGAAGTTCCGAGAGCGAGGGAAATCGGCCGAGGAGAG CTCTGAGCGAGGCGGGCAGCTTGGACGACAGCGGAGTCAGCAGCTCCGGA GGAAGCACGCCGCCGTTGGCCCACTCGCCGGGGAATTACACTCGATCGCC GTTGCGGACGCAGGAGAACGAGCGCAGAAGCGAGAGCGCTCAGCAGCCGG CGCGCCTGCACAGACCGTGGGCGGACTCGTCGTCGCCGACTCAACATATT CATCACCGAGTCCAAGAATCTCCGTTAGCGGCACCCTCCGCCACTCACCC AGCACTTGACTTTCATCTCTTCAATCCTTTTCTCCTTCCTTCCTCGCACC AGCATCACTTGGCGGCGCTGGAAATCGCGAGGTTCCAGCATCAGATGCAA CAGCATCGATACGCGAGCCAACATCTGGCCAAATTCTATCGCTGA
back to top

Coding sequence (CDS) from alignment at scaffold_1:557932..569526+

>g76.t1 ID=g76.t1|Name=g76.t1|organism=Venturia canescens|type=CDS|length=1248bp|location=Sequence derived from alignment at scaffold_1:557932..569526+ (Venturia canescens)
ATGGTGATAGAAGAAATAGCTCACACCAACGGCTGGCTCGTGCCCCCCAG
TCCCGGGGCAGGACCCTCGTTGCCTCACGGCGTCAAGATCGAGCTCCAGA
ACAAGAAGCTTTGGCGGCAATTTCACGCGGAGAGTACCGAAATGATAATC
ACGAAGCTTGGGCGGCGAATGTTCCCCGCCGTCCAACTGAACGTCTCCGG
CCTGGAGAGTCGCGCCCGTTACTGTCTCCTGCTGGAAATAGCTCCGGCCT
CCCGCCGCCGTCACAAGTACGTGGGAGCGAGCGGCGAGAATTCGTCGACT
CCTGGGACAACGCGGGGCTGGACGTCGGCGGGGCCGGCGGAGCCGCAGCC
CCGCATCAACCGGAGAGTTTACCTCCACCCGGACAGTCCTGCGACGGGGC
ATCACTGGATGCAGCATCCGGTCAGCTTCGGCAAGCTCAAGCTGACCAAC
AACGCGGTCGATCACCACAACAACGTGGTCCTCACTTCCATGCACAAATA
CATACCCAGAATATGGATCATTCGATGCGACGACCTCGCCAACATGAACA
ACCTCTACAGTCAACCTTCCGCCTCGTTCACCTTCGACGAAACCGAGTTC
ATCGCTGTCACCGCTTATCAGAACGAGAACATCACGAAGCTGAAGATCAA
CAACAATCCGTTTGCGAAGGGCTTCCGAGAGACGGGTCAGTCGCGCTGCA
AGAGGAAACTGCATCAAATGAACGAGAGGAGCGAGTCGAGCGCGGAGGAC
AGAAGCGCCTGCGAGGAGGAGGAAGAAAACGCATCGTCGTCGGAGTCGGA
GTCTCATAGGCCGAGGAGAAGTTCCGAGAGCGAGGGAAATCGGCCGAGGA
GAGCTCTGAGCGAGGCGGGCAGCTTGGACGACAGCGGAGTCAGCAGCTCC
GGAGGAAGCACGCCGCCGTTGGCCCACTCGCCGGGGAATTACACTCGATC
GCCGTTGCGGACGCAGGAGAACGAGCGCAGAAGCGAGAGCGCTCAGCAGC
CGGCGCGCCTGCACAGACCGTGGGCGGACTCGTCGTCGCCGACTCAACAT
ATTCATCACCGAGTCCAAGAATCTCCGTTAGCGGCACCCTCCGCCACTCA
CCCAGCACTTGACTTTCATCTCTTCAATCCTTTTCTCCTTCCTTCCTCGC
ACCAGCATCACTTGGCGGCGCTGGAAATCGCGAGGTTCCAGCATCAGATG
CAACAGCATCGATACGCGAGCCAACATCTGGCCAAATTCTATCGCTGA
back to top