g11303.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg11303.t1
Unique Nameg11303.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length467
Homology
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|1070589416|ref|XP_018407242.1| (PREDICTED: uncharacterized protein LOC108783225 [Cyphomyrmex costatus] >gi|1009383575|gb|KYN06157.1| hypothetical protein ALC62_02918 [Cyphomyrmex costatus])

HSP 1 Score: 715.3 bits (1845), Expect = 1.600e-202
Identity = 356/476 (74.79%), Postives = 407/476 (85.50%), Query Frame = 0
Query:    1 MKLFKFVFILACVVACS--------CETSQNDDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAV-PHEIDDQKPFSESEEERGPS 468
            M+++  VF + C   CS          ++  D    A++A GE+RLGDQIR ILKHYQQ DP+GLPGAPIPDPM VPD+KHSFS+YTMN K+I VYGLSKFRIEH+ SELA MQVSVA+ I+ LDIRGLYTLASW+SRS G+F VKL+ V V+G+ARLEV  DGKL AQDIDMDLTF+ IDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMA+AEARKQVS MGYDPY++KDY Q  GIF  TSSHTW+ G+ASFYR+GNIT+TMENGTVYA LDVGTQE+EG+THWEVSV+GG  SRAGT+SFT+QYFRVQ+KL+QPLDTRKRA LE+L LELGNIQAR HGA TLDY++EASVN++PN+LRYQIMDA+EGP+KRR+QEELDKVD+EKLI +KIP I EQAR + G V AE+ ILEE  + PH  DDQ PFSESEEERGPS
Sbjct:   11 MRVYAVVFFIVCCFLCSPCASKEPKASSTSIDKKTAAQIAAGEQRLGDQIRAILKHYQQDDPVGLPGAPIPDPMPVPDLKHSFSVYTMNFKQISVYGLSKFRIEHIESELARMQVSVAVKIDILDIRGLYTLASWISRSEGEFMVKLTGVKVEGIARLEVSTDGKLQAQDIDMDLTFDKIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNMRGEVNKQISQLPQYFPNSISPFDMAIAEARKQVSQMGYDPYQLKDYVQNIGIFTVTSSHTWIIGLASFYRMGNITITMENGTVYALLDVGTQELEGKTHWEVSVIGGFLSRAGTMSFTVQYFRVQVKLAQPLDTRKRAALEELELELGNIQARFHGARTLDYLVEASVNILPNLLRYQIMDAIEGPLKRRIQEELDKVDMEKLIDEKIPVIEEQARWMQGLVPAEETILEESTLPPHSQDDQTPFSESEEERGPS 486          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|954566925|ref|XP_014607475.1| (PREDICTED: uncharacterized protein LOC106788586 [Polistes canadensis])

HSP 1 Score: 712.6 bits (1838), Expect = 1.100e-201
Identity = 357/466 (76.61%), Postives = 402/466 (86.27%), Query Frame = 0
Query:    4 FKFVFILAC--VVACSCETSQNDDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            ++  F+L C     C  E ++ +     +LA GEKRLGD IR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFSMYTM  K+I VYGLSKFRIEH++SELALMQVS ALSI  LDIRGLYTLASWLSRSAG+FTV L+ V ++GVARLEVGADGKL AQDIDMDLTFENID+DFKNLGFLGSVFQGVINSVG FIFD IKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMAVAE R+QVS MGYDPYR+KDYSQ  GIF   SSHTW+TG+ASFYR+GNITL+MEN TVYA LDVGTQEIEGRTHWEVSV+GG+ SRAGTVSFT+QYFRVQL LSQPLDTRKR  LE+L+LELGNIQARIHGAGTLDY++EAS+N++PN+LRYQIMDA+EGP+KRR+QEEL+ +DVEKLI++KIPEI E A+ L G    ++IILE+   P   DD  PFSESEEERGPS
Sbjct:    5 YQLFFLLFCSSFFVCQAEDTKVNATEAEQLAAGEKRLGDHIRAILKHYQQHDPVGLPGAPIPDPMPVPDMKHSFSMYTMTFKQINVYGLSKFRIEHLKSELALMQVSAALSITRLDIRGLYTLASWLSRSAGNFTVILTGVNIEGVARLEVGADGKLQAQDIDMDLTFENIDMDFKNLGFLGSVFQGVINSVGAFIFDSIKPFILKEVNTNMRGEVNKQISQLPQYFPNSISPFDMAVAEGRRQVSQMGYDPYRLKDYSQNVGIFTVMSSHTWITGLASFYRMGNITLSMENRTVYAVLDVGTQEIEGRTHWEVSVIGGVLSRAGTVSFTVQYFRVQLNLSQPLDTRKRPTLEELDLELGNIQARIHGAGTLDYVMEASINILPNLLRYQIMDAIEGPLKRRIQEELNNIDVEKLINEKIPEIEEHAKFLQGLSPPDEIILEDPVPPQMPDDLTPFSESEEERGPS 470          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|1070215615|ref|XP_018377189.1| (PREDICTED: uncharacterized protein LOC108770217 [Trachymyrmex cornetzi] >gi|1070215617|ref|XP_018377190.1| PREDICTED: uncharacterized protein LOC108770217 [Trachymyrmex cornetzi] >gi|1070215619|ref|XP_018377191.1| PREDICTED: uncharacterized protein LOC108770217 [Trachymyrmex cornetzi] >gi|1009386885|gb|KYN09059.1| hypothetical protein ALC57_19027 [Trachymyrmex cornetzi])

HSP 1 Score: 712.6 bits (1838), Expect = 1.100e-201
Identity = 351/475 (73.89%), Postives = 408/475 (85.89%), Query Frame = 0
Query:    1 MKLFKFVFILACVVACS--------CETSQNDDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            M+++  VF++ C   CS         + +  D    A++A GE+RLGDQIR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFS+ T+NLK+I VYGLSKFRIEH+ SELA MQVSVA+ I+ LDIRGLYT+ SW+SRS GDFTVKL+ VIV+G+ARLEV  DGKL AQDIDMDLTF+ IDLDFKNLGFLGSVFQGVINSVG+FIFDGIKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMA+AEARKQVS MGYDPY++K Y+Q  GIF  TSSHTW+TG+ASFYR+GNIT+TMENGT+YA LDVGTQE+EG+THWEVSV+GG  SRAGTVSFT+++FRVQ+KL+QPLDTRKRA LE+L LELGNIQAR HGA TLDY++EASVN++PN+LRYQIMDA+EGP+KRR+QEEL+KVD+EKLI +KIP I EQAR + G   AE+ ILEE   P+  DDQ PFSESEEERGPS
Sbjct:   11 MRVYAVVFLIVCCFLCSPCASEELKAKNASIDKKTAAQIAAGEQRLGDQIRAILKHYQQDDPVGLPGAPIPDPMPVPDMKHSFSINTINLKKINVYGLSKFRIEHIESELARMQVSVAVRIDILDIRGLYTMTSWISRSEGDFTVKLTGVIVEGIARLEVSTDGKLQAQDIDMDLTFDKIDLDFKNLGFLGSVFQGVINSVGSFIFDGIKPFILKEVNTNIRGEVNKQISQLPQYFPNSISPFDMAIAEARKQVSQMGYDPYQLKGYTQSVGIFTMTSSHTWITGLASFYRMGNITITMENGTIYALLDVGTQELEGKTHWEVSVIGGFLSRAGTVSFTVKFFRVQVKLAQPLDTRKRATLEELELELGNIQARFHGARTLDYLVEASVNILPNLLRYQIMDAIEGPLKRRIQEELEKVDMEKLIDEKIPVIEEQARWMQGLAPAEETILEEPLPPNSQDDQTPFSESEEERGPS 485          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|1070198169|ref|XP_018354309.1| (PREDICTED: uncharacterized protein LOC108755669 [Trachymyrmex septentrionalis] >gi|1070198171|ref|XP_018354311.1| PREDICTED: uncharacterized protein LOC108755669 [Trachymyrmex septentrionalis] >gi|1009411932|gb|KYN30871.1| hypothetical protein ALC56_14683 [Trachymyrmex septentrionalis])

HSP 1 Score: 711.4 bits (1835), Expect = 2.300e-201
Identity = 353/477 (74.00%), Postives = 408/477 (85.53%), Query Frame = 0
Query:    1 MKLFKFVFILACVVAC----SCETSQN------DDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            M+++  VF++ C   C    S E   N      D    A++A GE+RLGDQIR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFS+ T+NLK+I VYGLSKFRIEH+ SELA MQVSVA+ I+ LD+RGLYT+ SW+SRS GDFTVKL+ V V+G+ARLEV  DGKL AQ+IDMDLTF+ IDLDFKNLGFLGSVFQGVINSVG+FIFDGIKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMA+AEARKQVS MGYDPY++KDY+Q  GIF  TSSHTW+TG+ASFYR+GNIT+TMENGT+YA LD+GTQE+EG+THWEVSV+GG  SRAGTVSFT+QYFRVQ+KL+QPLDTRKRA LE+L LELGNIQAR HGA TLDY++EASVN++PN+LRYQIMDA+EGP+KRR+QEELDKVD+EKLI +KIP I EQAR + G   AE+ ILEE   P+  DDQ PFSESEEERGPS
Sbjct:   11 MRVYAVVFLIVCCFLCFPCASEELKANNASTSIDKKTVAQIAAGEQRLGDQIRAILKHYQQDDPVGLPGAPIPDPMPVPDMKHSFSINTINLKKINVYGLSKFRIEHIESELARMQVSVAVRIDILDVRGLYTMTSWISRSEGDFTVKLTGVKVEGIARLEVSTDGKLQAQNIDMDLTFDKIDLDFKNLGFLGSVFQGVINSVGSFIFDGIKPFILKEVNTNIRGEVNKQISQLPQYFPNSISPFDMAIAEARKQVSQMGYDPYQLKDYTQSVGIFTMTSSHTWITGLASFYRMGNITITMENGTIYALLDIGTQELEGKTHWEVSVIGGFLSRAGTVSFTVQYFRVQVKLAQPLDTRKRATLEELELELGNIQARFHGARTLDYLVEASVNILPNLLRYQIMDAIEGPLKRRIQEELDKVDMEKLIDEKIPMIEEQARWMQGLAPAEETILEEPLPPNSQDDQTPFSESEEERGPS 487          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|972176930|ref|XP_015190492.1| (PREDICTED: uncharacterized protein LOC107073998 [Polistes dominula])

HSP 1 Score: 711.1 bits (1834), Expect = 3.100e-201
Identity = 359/470 (76.38%), Postives = 405/470 (86.17%), Query Frame = 0
Query:    4 FKFVFILAC----VVACSCETSQNDDDVEAK--LAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            ++  FIL C       C  E ++ +   EAK  +A GEKRLGD IR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFSMYTM  KEI VYGLSKFRIEH++SELALMQVS ALSI  LDIRGLYTL+SWLSRSAG+FTV L+ V ++GVARLEVGADGKL AQDIDMDLTFENID+DFKNLGFLGSVFQGVINSVG+FIFD IKPFIL+EVNTN+RGEVNKQISQLPQYFPNSISPFDMAVAE R+QVS MGYDPYRVKDYSQ  GIF   SSHTW+TG+ASFYR+GNITL+MEN TVYA LDVGTQEIEGRTHWEVSV+GG+ SRAGTVSFT+QYFRVQL LSQPLDTRKR  LE+L+LELGNIQARIHGAGTLDY++EAS+N++PN+LRYQIMDA+EGP+KRR+QEEL+K+DVEKLI++KIPEI E A+ L      ++IILE+   P   +D  PFSESEEERGPS
Sbjct:    5 YQVFFILLCSSSSFFVCQAEDAKVNAQEEAKEQIAAGEKRLGDHIRAILKHYQQNDPVGLPGAPIPDPMPVPDMKHSFSMYTMTFKEINVYGLSKFRIEHLKSELALMQVSAALSITRLDIRGLYTLSSWLSRSAGNFTVILTGVNIEGVARLEVGADGKLQAQDIDMDLTFENIDMDFKNLGFLGSVFQGVINSVGSFIFDSIKPFILREVNTNMRGEVNKQISQLPQYFPNSISPFDMAVAEGRRQVSQMGYDPYRVKDYSQNVGIFTVMSSHTWITGLASFYRMGNITLSMENRTVYAVLDVGTQEIEGRTHWEVSVIGGVLSRAGTVSFTVQYFRVQLNLSQPLDTRKRPTLEELDLELGNIQARIHGAGTLDYVMEASINILPNLLRYQIMDAIEGPLKRRIQEELNKIDVEKLINEKIPEIEEHAKFLQELTPPDEIILEDPVPPQIPEDLTPFSESEEERGPS 474          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|746854131|ref|XP_011057696.1| (PREDICTED: uncharacterized protein LOC105147985 [Acromyrmex echinatior] >gi|332023157|gb|EGI63413.1| hypothetical protein G5I_08141 [Acromyrmex echinatior])

HSP 1 Score: 710.7 bits (1833), Expect = 4.000e-201
Identity = 351/477 (73.58%), Postives = 407/477 (85.32%), Query Frame = 0
Query:    1 MKLFKFVFILACVVACSCETSQN----------DDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            M+++  VF++ C   CS   S+           D    A++A GE+RLGDQIR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFS+ T+NLK+I VYGLSKFRIEH+ SELA MQVSVA+ I+ LDIRGLYT+ SW+SRS GDF VKL+ V V+G+ARLEV  DGKL AQ+IDMDLTF+ IDLDFKNLGFLGSVFQGVINSVG+FIFDGIKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMA+AEARKQVS MGYDPY++KDY+Q  GIF  TSSHTW+TG+ASFYR+GNIT+TMENGT+YA LDVGTQE+EG+THWEVSV+GG  SRAGTVSFT+QYFRVQ+KL+QPLDTRKRA LE+L LELGNIQAR HGA TLDY++EASVN++PN+LRYQIMDA+EGP+KRR+QEELDK+D+EKLI +KIP I EQAR + G   +E+ ILEE   P+  DDQ PFSESEEERGPS
Sbjct:    9 MRVYAVVFLIVCCFLCSSCASEELKTNNASTSIDKKTAAQIAAGEQRLGDQIRAILKHYQQDDPVGLPGAPIPDPMPVPDMKHSFSINTINLKKISVYGLSKFRIEHMESELARMQVSVAVRIDILDIRGLYTMTSWISRSEGDFMVKLTGVKVEGIARLEVNTDGKLQAQNIDMDLTFDKIDLDFKNLGFLGSVFQGVINSVGSFIFDGIKPFILKEVNTNIRGEVNKQISQLPQYFPNSISPFDMAIAEARKQVSQMGYDPYQLKDYTQSVGIFTMTSSHTWITGLASFYRMGNITITMENGTIYALLDVGTQELEGKTHWEVSVIGGFLSRAGTVSFTVQYFRVQVKLAQPLDTRKRALLEELELELGNIQARFHGARTLDYLVEASVNILPNLLRYQIMDAIEGPLKRRIQEELDKIDMEKLIDEKIPMIEEQARWMQGLTPSEETILEEPLPPNSQDDQTPFSESEEERGPS 485          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|801399488|ref|XP_012060257.1| (PREDICTED: uncharacterized protein LOC105623473 [Atta cephalotes])

HSP 1 Score: 709.9 bits (1831), Expect = 6.800e-201
Identity = 352/477 (73.79%), Postives = 409/477 (85.74%), Query Frame = 0
Query:    1 MKLFKFVFILACVVAC----SCETSQN------DDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            M+++  VF++ C   C    S E   N      D  + A++A GE+RLGDQIR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFS+ T+NLK+I VYGLSKFRIEH+ SELA MQVSVA+ I+ LDIRGLYT+ SW+SRS GDF+VKL+ V V+G+ARLEV  DGKL AQDIDMDLTF+ IDLDFKNLGFLGSVFQGVINSVG+FIFDGIKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMA+AEARKQVS MGYDPY++KDY+Q  GIF  TSSHTW+TG+ASFYR+GNIT+TMENGT+YA LDVGTQE+EG+THWE+SV+GG  SRAGTVSFT+QYFRVQ+KL+QPLDTRKRA LE+L LELGNIQAR HGA TLDY++EAS+N++PN+LRYQIMDA+EGP+KRR+QEELDKV++EKLI +KIP I EQAR + G   AE+ ILEE   P+  DDQ PFSESEEERGPS
Sbjct:    9 MRVYTVVFLIVCCFLCFPCASEELKANNASTSLDKKMVAQIAAGEQRLGDQIRAILKHYQQDDPVGLPGAPIPDPMPVPDMKHSFSINTINLKKINVYGLSKFRIEHIESELARMQVSVAVRIDILDIRGLYTMTSWISRSEGDFSVKLTGVKVEGIARLEVSTDGKLQAQDIDMDLTFDKIDLDFKNLGFLGSVFQGVINSVGSFIFDGIKPFILKEVNTNIRGEVNKQISQLPQYFPNSISPFDMAIAEARKQVSQMGYDPYQLKDYTQSVGIFTMTSSHTWITGLASFYRMGNITITMENGTIYALLDVGTQELEGKTHWEMSVIGGFLSRAGTVSFTVQYFRVQIKLAQPLDTRKRATLEELELELGNIQARFHGARTLDYLVEASINILPNLLRYQIMDAIEGPLKRRIQEELDKVNMEKLIDEKIPMIEEQARWMQGLTPAEETILEEPLPPNSQDDQTPFSESEEERGPS 485          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|1009363505|gb|KYM88560.1| (hypothetical protein ALC53_03043 [Atta colombica])

HSP 1 Score: 709.9 bits (1831), Expect = 6.800e-201
Identity = 352/477 (73.79%), Postives = 409/477 (85.74%), Query Frame = 0
Query:    1 MKLFKFVFILACVVAC----SCETSQN------DDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            M+++  VF++ C   C    S E   N      D  + A++A GE+RLGDQIR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFS+ T+NLK+I VYGLSKFRIEH+ SELA MQVSVA+ I+ LDIRGLYT+ SW+SRS GDF+VKL+ V V+G+ARLEV  DGKL AQDIDMDLTF+ IDLDFKNLGFLGSVFQGVINSVG+FIFDGIKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMA+AEARKQVS MGYDPY++KDY+Q  GIF  TSSHTW+TG+ASFYR+GNIT+TMENGT+YA LDVGTQE+EG+THWE+SV+GG  SRAGTVSFT+QYFRVQ+KL+QPLDTRKRA LE+L LELGNIQAR HGA TLDY++EAS+N++PN+LRYQIMDA+EGP+KRR+QEELDKV++EKLI +KIP I EQAR + G   AE+ ILEE   P+  DDQ PFSESEEERGPS
Sbjct:    1 MRVYTVVFLIVCCFLCFPCASEELKANNASTSLDKKMVAQIAAGEQRLGDQIRAILKHYQQDDPVGLPGAPIPDPMPVPDMKHSFSINTINLKKISVYGLSKFRIEHIESELARMQVSVAVRIDILDIRGLYTMTSWISRSEGDFSVKLTGVKVEGIARLEVSTDGKLQAQDIDMDLTFDKIDLDFKNLGFLGSVFQGVINSVGSFIFDGIKPFILKEVNTNIRGEVNKQISQLPQYFPNSISPFDMAIAEARKQVSQMGYDPYQLKDYTQSVGIFTMTSSHTWITGLASFYRMGNITITMENGTIYALLDVGTQELEGKTHWEMSVIGGFLSRAGTVSFTVQYFRVQIKLAQPLDTRKRATLEELELELGNIQARFHGARTLDYLVEASINILPNLLRYQIMDAIEGPLKRRIQEELDKVNMEKLIDEKIPMIEEQARWMQGLTPAEETILEEPLSPNSQDDQTPFSESEEERGPS 477          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|1068386712|ref|XP_018060225.1| (PREDICTED: uncharacterized protein LOC108695019 [Atta colombica])

HSP 1 Score: 709.9 bits (1831), Expect = 6.800e-201
Identity = 352/477 (73.79%), Postives = 409/477 (85.74%), Query Frame = 0
Query:    1 MKLFKFVFILACVVAC----SCETSQN------DDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            M+++  VF++ C   C    S E   N      D  + A++A GE+RLGDQIR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFS+ T+NLK+I VYGLSKFRIEH+ SELA MQVSVA+ I+ LDIRGLYT+ SW+SRS GDF+VKL+ V V+G+ARLEV  DGKL AQDIDMDLTF+ IDLDFKNLGFLGSVFQGVINSVG+FIFDGIKPFILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMA+AEARKQVS MGYDPY++KDY+Q  GIF  TSSHTW+TG+ASFYR+GNIT+TMENGT+YA LDVGTQE+EG+THWE+SV+GG  SRAGTVSFT+QYFRVQ+KL+QPLDTRKRA LE+L LELGNIQAR HGA TLDY++EAS+N++PN+LRYQIMDA+EGP+KRR+QEELDKV++EKLI +KIP I EQAR + G   AE+ ILEE   P+  DDQ PFSESEEERGPS
Sbjct:    9 MRVYTVVFLIVCCFLCFPCASEELKANNASTSLDKKMVAQIAAGEQRLGDQIRAILKHYQQDDPVGLPGAPIPDPMPVPDMKHSFSINTINLKKISVYGLSKFRIEHIESELARMQVSVAVRIDILDIRGLYTMTSWISRSEGDFSVKLTGVKVEGIARLEVSTDGKLQAQDIDMDLTFDKIDLDFKNLGFLGSVFQGVINSVGSFIFDGIKPFILKEVNTNIRGEVNKQISQLPQYFPNSISPFDMAIAEARKQVSQMGYDPYQLKDYTQSVGIFTMTSSHTWITGLASFYRMGNITITMENGTIYALLDVGTQELEGKTHWEMSVIGGFLSRAGTVSFTVQYFRVQIKLAQPLDTRKRATLEELELELGNIQARFHGARTLDYLVEASINILPNLLRYQIMDAIEGPLKRRIQEELDKVNMEKLIDEKIPMIEEQARWMQGLTPAEETILEEPLSPNSQDDQTPFSESEEERGPS 485          
BLAST of g11303.t1 vs. GenBank_protein
Match: gi|1492488743|ref|XP_026673399.1| (uncharacterized protein LOC108629823 [Ceratina calcarata])

HSP 1 Score: 704.9 bits (1818), Expect = 2.200e-199
Identity = 346/466 (74.25%), Postives = 404/466 (86.70%), Query Frame = 0
Query:    2 KLFKFVFILACVVACSCETSQNDDDVEAKLAEGEKRLGDQIRLILKHYQQPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRSELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARLEVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDGIKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMGYDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASLDVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKRACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPIKRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHEIDDQKPFSESEEERGPS 468
            KL   +F    +  C    S  ++D  A++A GEKRLGD IR ILKHYQQ DP+GLPGAPIPDPM VPDMKHSFSMYTMN K + VYGLSKFRI HV SELALMQV+VALSIETLDIRGLYTL+SWLSRSAG+FTVKL+ V VQG+ARLEV +DGKL AQ+IDMDLTF+ ID+DFKNLGFL SV QGVINSVGTFIFD IKP ILKEVNTN+RGEVNKQISQLPQYFPNSISPFDMAVAEAR+QVS MGYDP++VKDYSQ AG+F  TS+HTW+TG+ASFYR+GNITL+MEN TVYA++D+GTQEIEGRTHWE+SV+GG  SRAGTVSFT+QY RVQ+KLSQPLDTRK+  +E+L+LELGNIQ R+HGAGT+DY++EASVN++PN+LRYQIMDA+EGP+KRR+Q EL KVDVEKLI++KIP+I EQAR L G V  E+ +LE+     ++D+Q PFSESEE+RGPS
Sbjct:   29 KLLLVLFCFLAIGRCDASKSGGENDTAAEIAAGEKRLGDHIRAILKHYQQDDPIGLPGAPIPDPMPVPDMKHSFSMYTMNFKHVNVYGLSKFRIVHVESELALMQVAVALSIETLDIRGLYTLSSWLSRSAGNFTVKLTGVNVQGIARLEVASDGKLQAQNIDMDLTFQKIDMDFKNLGFLASVLQGVINSVGTFIFDSIKPLILKEVNTNIRGEVNKQISQLPQYFPNSISPFDMAVAEARRQVSQMGYDPFKVKDYSQSAGMFTVTSTHTWITGLASFYRMGNITLSMENRTVYATIDIGTQEIEGRTHWEISVIGGFLSRAGTVSFTVQYLRVQIKLSQPLDTRKKPSVEELDLELGNIQTRVHGAGTIDYLMEASVNILPNLLRYQIMDAIEGPLKRRIQAELTKVDVEKLIYEKIPDIEEQARYLQGIVPPEETVLEQPMSALDMDEQ-PFSESEEDRGPS 493          
The following BLAST results are available for this feature:
BLAST of g11303.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1070589416|ref|XP_018407242.1|1.600e-20274.79PREDICTED: uncharacterized protein LOC108783225 [C... [more]
gi|954566925|ref|XP_014607475.1|1.100e-20176.61PREDICTED: uncharacterized protein LOC106788586 [P... [more]
gi|1070215615|ref|XP_018377189.1|1.100e-20173.89PREDICTED: uncharacterized protein LOC108770217 [T... [more]
gi|1070198169|ref|XP_018354309.1|2.300e-20174.00PREDICTED: uncharacterized protein LOC108755669 [T... [more]
gi|972176930|ref|XP_015190492.1|3.100e-20176.38PREDICTED: uncharacterized protein LOC107073998 [P... [more]
gi|746854131|ref|XP_011057696.1|4.000e-20173.58PREDICTED: uncharacterized protein LOC105147985 [A... [more]
gi|801399488|ref|XP_012060257.1|6.800e-20173.79PREDICTED: uncharacterized protein LOC105623473 [A... [more]
gi|1009363505|gb|KYM88560.1|6.800e-20173.79hypothetical protein ALC53_03043 [Atta colombica][more]
gi|1068386712|ref|XP_018060225.1|6.800e-20173.79PREDICTED: uncharacterized protein LOC108695019 [A... [more]
gi|1492488743|ref|XP_026673399.1|2.200e-19974.25uncharacterized protein LOC108629823 [Ceratina cal... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0008289 lipid binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010562Haemolymph juvenile hormone bindingSMARTSM00700jhbpcoord: 21..234
e-value: 4.3E-4
score: 2.1
IPR010562Haemolymph juvenile hormone bindingPFAMPF06585JHBPcoord: 22..225
e-value: 8.9E-18
score: 64.3
IPR038606Takeout superfamilyGENE3D3.15.10.30coord: 38..227
e-value: 8.4E-12
score: 47.0
IPR020234Mite allergen, group-7PFAMPF16984Grp7_allergencoord: 275..408
e-value: 5.2E-12
score: 46.2
IPR038602Mite allergen, group-7 superfamilyGENE3D3.15.10.50coord: 233..412
e-value: 2.4E-18
score: 68.4
NoneNo IPR availablePANTHERPTHR11008UNCHARACTERIZEDcoord: 3..429
NoneNo IPR availablePANTHERPTHR11008:SF13coord: 3..429
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 15..18
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 19..467
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 6..14
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..5
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..18
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..18
score: 6.0
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..23
score: 0.517
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.788
IPR017943Bactericidal permeability-increasing protein, alpha/beta domain superfamilySUPERFAMILY55394Bactericidal permeability-increasing protein, BPIcoord: 66..229

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_395contigscaffold_395:7836..13844 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g11303.t1g11303.t1Venturia canescensmRNAscaffold_395 7836..13844 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g11303.t1-PA ID=g11303.t1-PA|Name=g11303.t1|organism=Venturia canescens|type=polypeptide|length=467bp
MKLFKFVFILACVVACSCETSQNDDDVEAKLAEGEKRLGDQIRLILKHYQ
QPDPLGLPGAPIPDPMDVPDMKHSFSMYTMNLKEIKVYGLSKFRIEHVRS
ELALMQVSVALSIETLDIRGLYTLASWLSRSAGDFTVKLSDVIVQGVARL
EVGADGKLHAQDIDMDLTFENIDLDFKNLGFLGSVFQGVINSVGTFIFDG
IKPFILKEVNTNVRGEVNKQISQLPQYFPNSISPFDMAVAEARKQVSDMG
YDPYRVKDYSQKAGIFIFTSSHTWLTGIASFYRVGNITLTMENGTVYASL
DVGTQEIEGRTHWEVSVVGGMFSRAGTVSFTIQYFRVQLKLSQPLDTRKR
ACLEDLNLELGNIQARIHGAGTLDYILEASVNVIPNILRYQIMDAVEGPI
KRRVQEELDKVDVEKLIHDKIPEIAEQARLLNGGVAAEDIILEEVAVPHE
IDDQKPFSESEEERGPS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008289lipid binding
Vocabulary: INTERPRO
TermDefinition
IPR010562Haemolymph_juvenile_hormone-bd
IPR038606To_sf
IPR020234Mite_allergen_group-7
IPR038602Mite_allergen_7_sf
IPR017943Bactericidal_perm-incr_a/b_dom